fetish




FC2HDKARBDFSDSSMIDECAWDNNPJKSBJROYDCHRVIPXSSISHZGDMEYDWAAAMIDVSANDTTPPPDAWDDASD

2018-12-21
245 min

[DOCP-112]The Sexy Woman With A Beautiful Ass Shows Off Her Butt Bra And Seduces Me

  • yu tomita maria serizawa censoredlingerieDOCPprestigedoc premiumDOCP-112DOCP112118docp00112
    • 2018-12-21
    133 min

    [DOKS-463]Perverted Nose Jobbing Girls Are Getting Horny For The Scent Of Stinky Cock Scum

  • risa asai yumeno misaki censoredhandjobDOKSoffice k somaruDOKS-463DOKS46336doks00463
    • 2018-12-21
    19 min

    [122118_402]Sayo Ogura

  • sayo ogura uncensoredbig titsfetishpacopacomama
    • 2018-12-20
    157 min

    [NHDTB-216]Molesting Teachers Make Knee High Schoolgirls Legs Twitch Exposed With Several Egg Vibrators 2

  • censoredschoolgirlNHDTBnatural highkansukeNHDTB-216NHDTB2161nhdtb00216
    • 2018-12-20
    140 min

    [STARS-014]Mana Sakura When She's Fucked By A Big Dick And Orgasms With Her Big Ass In Full View, Her Asshole Tightens

  • mana sakura censoredanalsingle workSTARSsod createkaorusod starSTARS-014STARS0141stars00014
    • 2018-12-20
    93 min

    [OKP-026]Divine Panty Hose. Shuri Atomi. Married Women, Mothers, Working Office Ladies In Uniform, Etc. Savor Their Pantyhose From The Moist Soles Of Their Feet To Their Toes! Masturbation, Facesitting, Footjobs, Creampies, And Buttjob Bukkake- Anyth

  • atomi shuri censoredmature womansingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-026OKP0261okp00026
    • 2018-12-20
    120 min

    [RCTD-177]An Asshole-Spreading First Airline

  • akemi miu hamazaki mao censoredanalRCTDrocketroute yamazakiRCTD-177RCTD1771rctd00177
    • 2018-12-20
    127 min

    [NEO-668]Unresisting Babe With Cute, Troubled Face Gets Covered In Cum

  • miori hara censoredsingle workbukkakeNEOradixshio sakurabaneo radixNEO-668NEO668433neo00668
    • 2018-12-19
    120 min

    [GVG-794]Father In Law and Daughter In Law, Secret Creampie Fucking Manami Oura

  • manami oura censoredcreampiesingle workGVGglory questtsunemori takahashiGVG-794GVG79413gvg00794
    • 2018-12-19
    125 min

    [GVG-795]Mio Kimijima And Gross Guys' Passionate Licking Family Mio Kimijima

  • kimishima mio censoredbig titsblowjobGVGglory questGVG-795GVG79513gvg00795
    • 2018-12-19
    130 min

    [GVG-797]Village Doctor Old Man Face Licking Creampie Pervert Clinical Chart Yuna Ishikawa

  • yuna ishikawa censoredcreampiesingle workGVGglory questrokusaburo mishimaGVG-797GVG79713gvg00797
    • 2018-12-17
    132 min

    [FLAV-210]Sex With A Seductive Schoolgirl With A Big Ass In A School Swimsuit. Slender Body With A Small Waist And Big Ass. 94cm Hip. Yukine Sakuragi

  • yuki sakuragi censoredschoolgirlslutFLAVdigital arkdigital ark digital arkFLAV-210FLAV210flav00210
    • 2018-12-17
    148 min

    [FLAV-211]HYPER FETISH A Naughty Queen In A High Cut Outfit Yurika Aoi

  • yurika censoredbig titssquirtingFLAVdigital arkdigital ark digital arkFLAV-211FLAV211flav00211
    • 2018-12-16
    116 min

    [JUY-713]Mr. Sakai Is The Perfect Boss. But He's Secretly Obsessed With Big Butts... Yui Miho

  • miho yui censoredbig titsmature womanJUYmadonnaeitaro hagaeJUY-713JUY713juy00713
    • 2018-12-15
    67 min

    [121518_399]Ryo Asai

  • ryo asai uncensoredcreampieblowjobpacopacomama
    • 2018-12-14
    138 min

    [VRTM-397]We Discreetly Stroked Wives' Pussies Under the Kotatsu Table and They Got Soaking Wet! It's Been So Long They Cum Over and Over Even Though Their Husbands Are Next to Them! 3

  • anne mashiro natsuko mishima censoredcreampiebig titsVRTMv r producegoro koenjiVRTM-397VRTM397h-910vrtm00397
    • 2018-12-14
    164 min

    [XRW-607]A Woman Who Loves To Suck Cock Misuzu Kawana

  • misuzu kawana censoredblowjobslutXRWreal worksani nakamurareal real worksXRW-607XRW607172xrw00607
    • 2018-12-14
    130 min

    [GETS-099][*Shocking Turn Of Events] The Neighbor's Wife Came To Visit Me In A Dripping Wet Maxi Dress And Tempted Me! Her Bra And Panties Showing Through Her Wet, Clinging Clothes Made Me So Hard, I Lost Control And Pushed Her Down... And Someth

  • censoredslutGETSprestigescoreGETS-099GETS099118gets00099
    • 2018-12-14
    120 min

    [XRW-614]This Young Wife Is Unconsciously Getting Men Excited With Her Bra Slippage And That's Why She Got Raped Yu Amaki

  • yu amagi censoredcreampielingerieXRWreal worksreal real worksXRW-614XRW614172xrw00614
    • 2018-12-14
    305 min

    [SABA-481]An Amateur Nude Pictorial A Highly Educated College Girl

  • censoredamateurSABAskyu shirotoSABA-481SABA481h-244saba00481
    • 2018-12-14
    121 min

    [SUPA-406]We Deliver College Girl Interns You Can Bukkake. 1

  • censoredcreampieSUPAclass s amateurvermilionSUPA-406SUPA406h-244supa00406
    • 2018-12-14
    130 min

    [SABA-486]Make Me Lick And Slurp Your Asshole Perverted Amateurs Who Love To Lick Anal Holes Are Making Their Adult Video Debuts

  • censoredanalamateurSABAskyu shirotoSABA-486SABA486h-244saba00486
    • 2018-12-14
    240 min

    [UMSO-223]All You Need Is Courage! Picking Up Working Women Special. Izakaya, Hostess Bar, Karaoke Bar Workers. 12 Women, 4 Hours

  • censoredcreampiebig titsUMSOk m produceumanamiUMSO-223UMSO22384umso00223
    • 2018-12-13
    120 min

    [HZGD-096]Her Son's Best Friend. Mom's Addicted To His Hard Dick. Sayaka Akagi

  • aya takashiro censoredcreampiebig titsHZGDhitodzuma hanazono gekijouoosaki hirokoujiHZGD-096HZGD096h-1100hzgd00096
    • 2018-12-13

    [121318_397]Asuka Ichinose

  • asuka ichinose uncensoredfetishpacopacomama
    • 2018-12-13
    70 min

    [GEKI-009]Turned On By The Ass Of A Barely Legal Girl In Gym Shorts, I Had To Fuck Her Right There And Then! She Can't Escape The Big Cock And Intense Fucking, She Convulses And Orgasms! It's Rare To Find A Girl Who Still Likes To Wear Gym Sh

  • sakaegawa noa censoredschoolgirlsingle workGEKIan amazingly rare amateurpeace makerGEKI-009GEKI009geki00009
    • 2018-12-13
    216 min

    [HUNTA-530]I Got A Job At A Day Care Center And I'm The Only Man!？ The Nursery Teachers' Asses In Tight Pants Turn Me On!! When I Look Around The Busy Day Care Center, All I See Are Nursery Teachers In Tight Pants, They're So Sexy! Workin

  • censoredHUNTAhuntercognac kaminohhh groupHUNTA-530HUNTA530hunta00530
    • 2018-12-10
    131 min

    [REQ-428]Let Me Help You Jack Off! Cute Girls Grip Your Dick And Help You Ejaculate 5

  • censoredbig titsblowjobREQbullittshinobu kamezushameREQ-428REQ428h-100req00428
    • 2018-12-10
    244 min

    [RHE-627]A Horny Volutpuous Mature Woman Who Likes To Secretly Fuck Young Men While Nobody's Looking 12 Ladies/4 Hours

  • censoredbig titsmature womanRHEhot entertainmentRHE-627RHE62759rhe00627
    • 2018-12-09
    169 min

    [MIAE-345]Dignified And Strong Female Investigators... Are Tied Up With Their Asses Fully Exposed And Pleasured Until Their Assholes Twitch And Orgasm. "I Lose! I Already Came!" Eventually They Submit! That Only Turns Their Enemies On Even Mo

  • shinoda yu yui hatano censoredsquirtingMIAEmoodyzdragon nishikawamoodyz acidMIAE-345MIAE345miae00345
    • 2018-12-09
    120 min

    [MIAE-349]Sexy Hip Oil Massage Mao Kurata Her Huge Ass Shakes And Shudders While She Reaches Coregasm

  • kurata mao censoredsingle workMIAEmoodyzgoemonmoodyz acidMIAE-349MIAE349miae00349
    • 2018-12-09
    120 min

    [IPX-239]An Elite Investigator Gets Pregnancy Fetish Gang Bang Fucked She Was Fucked By The Molester Gang... Tsubasa Amami

  • amami tsubasa censoredcreampiesingle workIPXidea pocketichigoharadishIPX-239IPX239ipx00239
    • 2018-12-08
    125 min

    [ARM-721]Another Day At The Massage Parlor [Extra Edition] The Skilled Therapist In Her Sexual Prime Gives Attractive Male Clients Extra Services

  • ryoko ikeuchi nanako miyamura censoredhandjobARMaroma planningaromaARM-721ARM721arm00721
    • 2018-12-07
    248 min

    [MLSM-014]Beautiful Mature Woman Babes Best Hits Collection Miko Koike 4 Hours A Mind-Blowing Beautiful Madonna!

  • emiko koike censoredcreampiemature womanMLSMmellow moonMLSM-014MLSM014mlsm00014
    • 2018-12-07
    152 min

    [MGMP-038]"Real Man Squirting!!" It Feels Way Better Than Ejaculation

  • maki kyoko mio morishita censoredsquirtingslutMGMPmegamibeautiful goddess premiumMGMP-038MGMP038mgmp00038
    • 2018-12-07
    240 min

    [DVDMS-339]Bringing Her Home, Inserting My Big Dick Into Her From Behind While Looking At Her Panty-Shot Ass And Fucking Her Straight Away! Her Sensitive Pussy Orgasms Right Away From The Sudden Penetration And When I Keep Fucking Her Relentlessly, S

  • censoredcreampieschoolgirlDVDMSdeep sswing nagaseDVDMS-339DVDMS339dvdms00339
    • 2018-12-07
    123 min

    [KTB-011]Bukkake! Pantyhose Stockings - I Wore These Pantyhose Stockings With Your Favorite Outfits -

  • the starry sky ayano kato censoredbukkakeKTBkahanshin tigers mousouzokukahanshin tigersKTB-011KTB011ktb00011
    • 2018-12-07
    163 min

    [MEAT-017]Voluptuous Thighs In Knee-High Socks Total Domain Momo Shiraishi

  • momo shiraishi censoredsingle workMEATbig fleshy road family daydreamomaruMEAT-017MEAT017meat00017
    • 2018-12-06
    120 min

    [JUY-698]Fuck Me Wildly From Behind... ~Doggy-Style Sex To Satisfy A Married Woman's Rape Fantasy~ Miori Ayaha

  • ayaba miori censoredbig titsmature womanJUYmadonnashiro shotenJUY-698JUY698juy00698
    • 2018-12-06
    93 min

    [OKP-025]Divine Pantyhose. Misa Suzumi. Savoring The Moist Pantyhose On The Beautiful Legs Of Married Women, Mothers And Office Ladies In Uniform, From The Soles Of Their Feet To Their Toes! Masturbation, Face Sitting, Footjobs, Creampies, Buttjobs A

  • ryoumi misa censoredmature womansingle workOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-025OKP0251okp00025
    • 2018-12-06
    180 min

    [120618_392]Sera Ichijyo

  • sera ichijyo uncensoredcreampieblowjobpacopacomama
    • 2018-12-06
    145 min

    [BF-560]The Elite Secretary Of A Major Company. Her Secret Fetish And Deep-Throat Sex. Sumire Kurokawa

  • sumire kurokawa censoredcreampiedeepthroatBFbefreenakibesoBF-560BF560bf00560
    • 2018-12-06
    148 min

    [SSNI-361]The Bra-Less Girl With Wet, See-Through Clothes Has Big, Erotic Nipples... Miharu Usami

  • miharu hanasaki censoredbig titsbeautiful girlSSNIs1 no 1 styleusa pyonSSNI-361SSNI361ssni00361
    • 2018-12-06
    93 min

    [OKB-053]Plump, Big Ass. Divine Gym Shorts. Mami Miyamoto. From Beautifu Lolitas To Married Women, We Get Chubby Girls To Put On Tight Gym Shorts And Gym Clothes And Get Extreme Close-Ups Of Their Peeping Panties And Moist Pussies! Also Includes Butt

  • miyamoto yumi censoredsingle workOKBdaddy s private photosgoddess in bloomersOKB-053OKB0531okb00053
    • 2018-12-01
    121 min

    [HDKA-155]The Naked Maid The Nude Maid Dispatch Center Hikari Sakuraba

  • sakuraba hikari censoredcreampiebig titsHDKAplanet plusbirdman teppeirafu shukoHDKA-155HDKA155h-237hdka00155
    • 2018-12-01
    29 min

    FC2PPV 990685 [Fifty huge breasts] Shameful swimsuit Tokie’s huge breasts nipples [Fetish] [Licking nipples licking]

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online