airi sato




FC2CESDJUFECHRVSPRDNACXEBODROYDAUKGMIDEMIDVGVHPPPDMEYDWAAAHDKASTARSMVSDMARANATRHUNTB

2020-12-25
51 min

[MASE-010][Available Online For A Limited Time] 40-Something Mademoiselle Fucked And Creampied Trophy Wife Loses Her Mind Haru

  • censoredcreampiemarried womanMASEcrystal picturemadam maniac plusMASE-010MASE01049mase00010
    • 2020-12-27
    120 min

    [BIJN-191]The Documentary She's Baring Her Instinct To Fuck And Enjoy Orgasmic Sex A Tall And Beautiful Married Woman Moans And Groans In Mind-Blowing Orgasmic Pleasure Kotono Nanasaki

  • kotono nanasaki censoredcreampiesingle workBIJNbijin majo emmanuelleBIJN-191BIJN191bijn00191
    • 2020-12-27
    255 min

    [SQTE-350]Ultimate Blowjob 31 Shots, S-Cute Blowjob Collection 2021

  • aoi kururugi chiharu miyazawa censoredblowjobbeautiful girlSQTEs cuteSQTE-350SQTE350sqte00350
    • 2021-01-01
    120 min

    [HDKA-224]Naked Home Visiting Caregiver - Shoko Ueki

  • shoko ueki censoredcreampieblowjobHDKAplanet plusdirector onudityHDKA-224HDKA224h-237hdka00224
    • 2021-01-04
    151 min

    [C-2603]Please Fuck My Wife - S-On (27) 90

  • censoredCgo go zukaraki take shigogos coreC-2603C2603140c02603
    • 2021-01-20
    180 min

    [FUFU-196]Sore Wives Tricked Into Erotic Massages... 180 Minutes

  • asako morishita aya ikegami censoredamateurmature womanFUFUstar paradisefufuFUFU-196FUFU196h-254fufu00196
    • 2021-01-22
    72 min

    FC2PPV 1654786 [Major company model] Leaked ● Hard raw acme SEX at a secret cosplay photo session. A narrow pussy is opened with a thick cock and acme died in a few minutes. Forced seeding as it is (leaked Gonzo data)

  • amateur uncensoredfc2
    • 2021-01-30
    169 min

    [JUFE-251]Obedient And Submissive Fast Food Trainee Employee With Colossal Tits Is Now My Dicksucking Pet: Hana Himesaki

  • himesaki hana censoredcreampiebig titsJUFEfitchJUFE-251JUFE251jufe00251
    • 2021-02-06
    181 min

    [NKKD-196]My Wife (28 Years Old) Got Fucked By The Part-Time Worker (20 Years Old) At Her Part-Time Job... And I Was Feeling So Frustrated And Angry That I Want To Sell This Footage As An Adult Video. (NKKD-196)

  • censoredmature womanslutNKKDjet eizomanji groupNKKD-196NKKD196nkkd00196
    • 2021-02-12
    206 min

    [UMSO-369]She Gets A Call From The Husband While Having Sex With Another Man!! Urged On By Her Partner, She Answers The Phone And Tries Her Best Not To Moan, But Things Are Heating Up To The Max! Will She Get Caught？! 11

  • tomoe nakamura asagiri hikari censoredlesbianmature womanUMSOk m produceumanamiUMSO-369UMSO36984umso00369
    • 2021-02-15
    180 min

    [DIPO-089]Top Secret Hidden Camera Footage Leaked Online! Middle-Aged Man Secretly Filmed His Sweaty Sex With A Married Woman With Colossal Tits 5 - Innocent Married Hottie Seduced By His Smooth Moves...

  • censoredbig titsmarried womanDIPOprimoheronandezDIPO-089DIPO089h-283dipo00089
    • 2021-03-03
    87 min

    [hoi-164]ARISA(26)

  • amateur censoredbig titsamateurhoihoi-164hoi164hoi-164
    • 2021-03-11
    63 min

    [orec-710]みなみん

  • amateur censoredcreampiebig titsorecorec-710orec710orec-710
    • 2021-03-17
    81 min

    FC2PPV 1730738 [First time limited 1000pt off] Beautiful wife of celebrity from Hong Kong ❤️ Appearance The aircraft is "I want to H" ❤️ I do not know in overseas notation … Big breasts？ Big tits! ❤️ Enchanted by the cock after a long ti

  • amateur uncensoredfc2
    • 2021-03-18
    71 min

    [REBD-541]Jun Another Heaven/Jun Harumi

  • jun shunmei censoredsingle workREBDrebeccaherpes takaREBD-541REBD541h-346rebd00541
    • 2021-03-22
    128 min

    [HOMA-103]

  • mahiro ichiki censoredschoolgirlbeautiful girlHOMAh m p doramajo asagiriHOMA-103HOMA103homa00103
    • 2021-04-10
    154 min

    [CESD-991]We Film Whatever Kana Morisawa Wants To Do Kana Morisawa

  • kana morisawa kanako iioka censoredcosplaymature womanCESDceleb no tomoCESD-991CESD991cesd00991
    • 2021-04-11
    30 min

    FC2PPV 1764394 [3P Orgy] [Snow Skin / Snow Breasts] 20-year-old JD who both parents lost their jobs and had to expose their beautiful skin to earn school fees. In her first orgy in her life, she holds two cocks in her upper and lower mouths

  • amateur uncensoredfc2
    • 2021-04-17
    211 min

    [DASD-855]Genuinely Addicted to Anal Fucking: Roughing It Into All Holes SP

  • censoredanalbig titsDASDdaskogoro kindaichiDASD-855DASD855dasd00855
    • 2021-04-18
    121 min

    [RAPD-001]Ravished Outdoors - Married Women Made To Fuck A Psychopath Who Caught Them Deep In The Mountains - Tearful Wives Mercilessly Pounded Shiori Tsukada Shoko Akase Nao Yuki

  • shiori tsukada naoko akase censoredRAPDglobal media entertainmentkikujiro akabaner e global media entertainmentRAPD-001RAPD001rapd00001
    • 2021-04-18
    120 min

    [JSOP-001]New: Alluring Bathhouse Cougar - Passionate Mature Sex At A High Class Soapland Brothel Mio Morishita

  • mio morishita censoredmature womansingle workJSOPglobal media entertainmentyayoi nakanomature japanese soaplandJSOP-001JSOP001jsop00001
    • 2021-04-18
    131 min

    [ANZD-075]Pure Amateur Babes Get Horny For Wild Fucks After A Little Liquor!

  • censoredamateurANZDanzu daydream vacationanzuANZD-075ANZD075anzd00075
    • 2021-04-21
    69 min

    259LUXU-1403 Luxury TV 1394 A beautiful president’s secretary makes an AV appearance saying "I want to taste the pleasures I do not know yet"! When the slender body is blamed carefully, a splendid nipple erects splendidly! Pleasure penet

  • amateur censoredamateurluxuluxu-1403luxu1403259luxu-1403
    • 2021-04-22
    34 min

    Pacopacomama 042221_463 The Spring Show : Standing Urination Special Rina Suzuki

  • amateur uncensoredpacopacomama
    • 2021-05-14
    135 min

    [HUNBL-046]Accosting A Woman, Pushing Her Up Against The Wall And Cumming On Her Bare Thighs Before Sticking My Cum Covered Dick In Her Pussy And Fucking Her Raw

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-046HUNBL046hunbl00046
    • 2021-05-14
    179 min

    [SSIS-075]Fresh Face NO.1 STYLE: Konan Sayoi AV Debut

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-075SSIS075ssis00075
    • 2021-05-16
    117 min

    [MXGS-1183]Record Of The Time I Partied Too Hard At The Coming Of Age Celebration And Fucked My Female Friend Hana Himesaki

  • himesaki hana censoredcreampiebig titsMXGSmaxingMXGS-1183MXGS1183h-068mxgs01183
    • 2021-05-28
    136 min

    [MIDE-933]My Big Tits Girlfriend And I Confined Ourselves To A 2-Day, 1-Night Hot Spring Resort Vacation Where All We Did Was Fuck Our Brains Out Fumika Nakayama

  • nakayama fumika censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-933MIDE933mide00933
    • 2021-06-02

    FC2PPV 1849089 Limited price until 7th [Uncensored] Get out of the OL work of glasses and cum inside a secret meeting at the hotel

  • amateur uncensoredfc2
    • 2021-06-11
    178 min

    [DASD-872]Dual Special - The Ultimate Three-Some Harem Starring A Super Cute Transsexual Duo Sara Aizawa Rui Nanase

  • aizawa sara nanase rui censoredbeautiful girlDASDdasnao masakiDASD-872DASD872dasd00872
    • 2021-06-26
    61 min

    1Pondo 062621_001 Full body massage by a sailor cutie: Asuka Uchiyama

  • amateur uncensored1pondo
    • 2021-06-30
    46 min

    475SKCK-036 Satsuki 1

  • amateur censoredanalamateurskckskck-036skck036475skck-036
    • 2021-07-02
    120 min

    [ADN-326]Sweaty Sex With My Female Boss In A Sweltering Office With No Air Conditioning In The Middle Of Summer Riona Hirose

  • rio hirose censoredcreampiesingle workADNattackerskitorune kawaguchiotona no dramaADN-326ADN326adn00326
    • 2021-07-02
    124 min

    [NKKD-216]Her Husband's Boss Is An Ass Lover... And He's Got His Eye On This Chaste Wife's Perky Booty Yu Shinoda

  • shinoda yu censoredbig titsmature womanNKKDjet eizoNKKD-216NKKD216nkkd00216
    • 2021-07-02
    119 min

    [BBAN-331]No. 1 In Repeat Customers! No. 1 Among Cheaters! Married Woman Hires Lesbian Hooker With Big Tits Nene Tanaka Ka Ayano Fuji

  • nene tanaka ayano kato censoredbig titslesbianBBANbibianBBAN-331BBAN331bban00331
    • 2021-07-10
    127 min

    [MDS-893]A Trip to an Orgy at an Onsen with a Neat and Clean Bitch with Black Hair. Urara Kaon.

  • hanaoto urara censoredcreampiebeautiful girlMDSuchu kikakumiyaba memberMDS-893MDS893mds00893
    • 2021-07-13
    61 min

    521MGFX-007 Excavation ☆ Breast Milk Amateur 1

  • amateur censoredcreampieschoolgirlmgfxmgfx-007mgfx007521mgfx-007
    • 2021-07-14
    186 min

    [HUNTB-052]I Was A Runaway, And This Kindly Slutty Elder Sister Type Took Me In, And We Started Living Together In A Dream-Cum-True Quickie Sex Life! Am I Living The Life Of A Fuck Fest Cock!？ I Was Going Through Various Problems At Home, So I Decide

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-052HUNTB052huntb00052
    • 2021-07-16
    55 min

    Caribbeancom 071621-001 The most important duty of nurse is helping patients ejaculate Yui Kisaragi

  • yui kisaragi uncensoredhandjobbukkakecaribbeancom
    • 2021-08-01
    127 min

    [MARA-060]夕季ちとせの爆乳劇場 Jcup！110cm

  • chitose in the evening censoredcreampiebig titsMARAplanet plusdirector omarakasuMARA-060MARA060h-237mara00060
    • 2021-08-26
    124 min

    [MOND-220]With My Lovely Senior Kyoko Maki

  • maki kyoko censoredmature womansingle workMONDtakara eizouhotate ikkandaiichi housouMOND-220MOND22018mond00220
    • 2021-08-27
    62 min

    529STCV-001 Madoka

  • amateur censoredcreampieamateurstcvstcv-001stcv001529stcv-001
    • 2021-09-06
    41 min

    292MY-498 Mitoma honoka 2

  • amateur censoredcreampiebig titsmymy-498my498292my-498
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-14
    65 min

    HEYZO 2609 Deep Kiss, Furious Sex -Lascivious Teacher’s Seduction- – Asuka Motomiya

  • asuka motomiya uncensoredcreampieheyzo
    • 2021-09-16
    82 min

    [REBD-589]Megu The Real Face That Even My Husband Doesn"t Know

  • mio meg censoredsingle workREBDrebeccasawamura akiraREBD-589REBD589h-346rebd00589



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online