asagiri jou




FC2NNPJEBODNACXVEMAROYDSANSSNIRBDSTARSSPRDADNNATRSQTEDASDWAAAMARADASDKSBJAPODBLK

2020-12-05
143 min

[JUL-395]My Naughty Former Teacher Hired Me As A Callgirl And Made Me Into His Obedient Sex Pet... Mahiro Ichiki

  • mahiro ichiki censoredmature womansingle workJULmadonnajotaro tomiJUL-395JUL395jul00395
    • 2020-12-11
    205 min

    [GNAB-041]Let's Fuck In The Countryside! Picking Up Girls For Creampies On Vacation

  • censoredcreampiemarried womanGNABprestigebang prestigeGNAB-041GNAB041118gnab00041
    • 2021-01-04
    60 min

    SIRO-4379 [First shot] [Shortcut beauty] [Beauty member panting indecently] A slender girl who applied for stress relief. Don’t miss the moment when the shy smile turns into an ecstatic expression. AV application on the net → AV experience shoot

  • amateur censoredamateursirosiro-4379siro4379siro-4379
    • 2021-01-04
    36 min

    FC2PPV 1631676 [Personal shooting] The tongues of the three men and the meat sticks blame the wife’s erogenous zone one after another! !!

  • amateur uncensoredfc2
    • 2021-01-07
    87 min

    HEYZO 2461 Circle Of Sex-holic Pornstars -Jyun Mamiya- – Jyun Mamiya

  • jyun mamiya uncensoredheyzo
    • 2021-01-13
    46 min

    302GERK-341 Kana

  • amateur censoredcreampieamateurgerkgerk-341gerk341gerk-341
    • 2021-01-15
    54 min

    [EMOI-043]Going To Tokyo, Picking Up Guys And Making Them Lose Their Virginity. I Told You Osaka Girls Were Hot. Tsukino Nonomiya/An Erotic Girl.

  • tsukino nonomiya censoredbig titsEMOIsod createtiger gavelemo girlEMOI-043EMOI0431emoi00043
    • 2021-01-16
    56 min

    H0930 ki210117 Yuri Arishima 35years old

  • amateur uncensoredh0930
    • 2021-01-17
    149 min

    [LZPL-056]Collosal Tits And Ass Lesbian Series Yuri Honma Yuria Yoshine

  • really yoshine yuria censoredbig titsLZPLlesreultimate ryolezure playLZPL-056LZPL056lzpl00056
    • 2021-01-26
    137 min

    1Pondo 012621_001 Runa Hinata : Runa Hinata Special Edition

  • amateur uncensored1pondo
    • 2021-02-05
    122 min

    [ONEZ-274]Escort Does Everything You Want Yukine Amazawa vol. 003

  • yukine amazawa censoredcreampieuniformONEZprestigetodoonezONEZ-274ONEZ274118onez00274
    • 2021-02-12
    206 min

    [UMSO-369]She Gets A Call From The Husband While Having Sex With Another Man!! Urged On By Her Partner, She Answers The Phone And Tries Her Best Not To Moan, But Things Are Heating Up To The Max! Will She Get Caught？! 11

  • tomoe nakamura asagiri hikari censoredlesbianmature womanUMSOk m produceumanamiUMSO-369UMSO36984umso00369
    • 2021-02-22
    148 min

    [CESD-978]Totally Freshly Filmed Footage Of Real And Deep And Rich Sex With Ayano Fuji In 4 Exclusive Fucks!

  • ayano kato censoredmature womanslutCESDceleb no tomoCESD-978CESD978cesd00978
    • 2021-02-24
    73 min

    FC2PPV 1700461 [First time limited 1980] I cup loli huge breasts beautiful wife ❤️ Live-action erotic cartoon state with anime voice ❤️ First nipple orgasm continuous Ikase ❤️ Pile up a meat stick for the first time in half a year with a big butt Cum

  • amateur uncensoredfc2
    • 2021-02-26
    43 min

    [CLO-129]A Stubborn And Relentless Massage Parlor Where, No Matter What Part Of Your Body Is Being Treated, They'll Always Make Sure To Drop By Your Nipples Meisa Chiba

  • chibana meisa censoredslutCLOchobitchchovicCLO-129CLO129h-1435clo00129
    • 2021-02-28
    107 min

    [VENX-011]New Exclusive Actress! - Do You Get Excited By Older Women's Panties？ A Stepmom Uses Her Panties To Seduce Her Stepson And D***k Every Drop Of His Cum! - Minami Nagata

  • minami nagata censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-011VENX011venx00011
    • 2021-03-03
    16 min

    FC2PPV 1710106 Goddess Bitchiri Sachii, who exchanges contacts with her followers and connects in many ways, is coming again!

  • amateur uncensoredfc2
    • 2021-03-12
    90 min

    [DHT-256]Score A MILF F-Cup With Long, Beautiful Legs In A Miniskirt! Ms Kayo Age 31

  • censoredcreampiebig titsDHThot entertainmentstudio zeroDHT-256DHT25659dht00256
    • 2021-03-13
    110 min

    [VEMA-159]Naughty Teacher Makes A House Call, But Her S*****t's Parents Aren't Home - Tongue-Lavishing French Kiss Seduction Nao Nakano

  • nanao nakano censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-159VEMA159vema00159
    • 2021-03-17
    41 min

    FC2PPV 1729752 * None * I’m sorry for my husband ( ∀) Married woman KUREHA 8 months pregnant just before giving birth! Demon Iki in the last rich affair raw Saddle SEX ♡

  • amateur uncensoredfc2
    • 2021-03-19
    102 min

    [OMHD-005]Cursed Sex Doll Is Possessed With A Devilish Lust Ichika Matsumoto

  • ichika matsumoto censoredblowjobsingle workOMHDdogmamigiwa otaOMHD-005OMHD005omhd00005
    • 2021-03-27
    119 min

    [JJBB-007]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 07

  • censoredcreampiemature womanJJBBjukujo japanJJBB-007JJBB007jjbb00007
    • 2021-04-08
    62 min

    Pacopacomama 040821_457 Horny Wife Helps to Lose Younger Boy’s Virginity 3 Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-04-10
    108 min

    [VEMA-162]Plain Jane Secretary Is A Secret Slutty Wife Type With Big Tits! She's So Kind That She Doesn't Get Mad Even When I Cum Inside Of Her! Yukino Nagisa

  • yukino nagi censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-162VEMA162vema00162
    • 2021-04-14
    160 min

    [BLK-494]She'll Drain Your Spank Bank Dry! Raw Fucks With A Pouty Slut! Her Wild, Incredible Body Will Send You Straight To Creampie Heaven

  • censoredcreampieblowjobBLKkira kirakira kira black galBLK-494BLK494blk00494
    • 2021-04-16
    92 min

    483SGK-022 [Overwhelming De M] [Model Class God Style] [Demon Iki Continuous Climax] [Libido is Unusual] [Continuous 3P Creampie 4 Shots] [No longer Revechi] * Gal Special News * The level is different this time! !! The style is divine! Libido is a m

  • amateur censoredcreampiebig titssgksgk-022sgk022483sgk-022
    • 2021-05-21
    138 min

    [JUL-584]After The Graduation Ceremony... A Gift From my Mother-in-law For Becoming An Adult. Marika Kobayashi

  • marika kobayashi censoredbig titsmature womanJULmadonnahimu lockJUL-584JUL584jul00584
    • 2021-05-23
    63 min

    FC2PPV 1832637 An executive of a fast-growing rumored venture company and a miracle H ❤️❤️ I have vaginal cum shot twice as I desire ❤️❤️

  • amateur uncensoredfc2
    • 2021-05-28
    41 min

    [HEYZO-2541]Darcia Creampie in Europe ＃Darcia3

  • darcia uncensoredheyzo
    • 2021-06-10
    179 min

    [NHDTB-540]We Hate Our Gross Step Father, But... Big Titty Step Sisters Are Given Aphrodisiacs And Become So Horny They Fight Over Their Step Father's Dick And Fuck Him At The Same Time

  • censoredbig titssisterNHDTBnatural highkansukeNHDTB-540NHDTB5401nhdtb00540
    • 2021-07-03
    117 min

    [SNTJ-022]Former Rugby Player Takes Her to a Hotel, Films the Sex on Hidden Camera, and Sells it as Porn. vol. 22

  • censoredbig titsamateurSNTJsojitsusha mousouzokuSNTJ-022SNTJ022sntj00022
    • 2021-07-06
    41 min

    H4610 ki210706 Kanami Watanuki 26years old

  • amateur uncensoredh4610
    • 2021-07-09
    151 min

    [MIFD-169]In a Shared Room Returning From an Idol Event, To Manage the Stress From Being Banned From Romance, She Fucks and Gets Creampie Sex with the Producer Until Her Libido is Eliminated. Ami Yozora

  • ami yozora censoredcreampiebeautiful girlMIFDmoodyznabemoodyz freshMIFD-169MIFD169mifd00169
    • 2021-07-17
    23 min

    FC2PPV 1927891 [Toys] A 145 Cm Mini Girl! Husband Is Not Good. It’S Too Intense And Patience, Wow, [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-08-22
    98 min

    300NTK-626 [Indecent G Breast Nippon Representative Class Boyne Beauty JD & Slender International Student And Throat 4p Special! !! ] Powerful Big Pie That Jumps Out Of Cosplay! !! Reason Collapses On A Sizzle-Filled Nipple! !! Big Explosion! !! W

  • amateur censoredcreampiebig titsntkntk-626ntk626300ntk-626
    • 2021-09-04
    51 min

    [DANDAN-014]A Seductive Wife!？ She Has A Sexy White Dress On Showing Off Her Ass, Leading To A Mistaken Quickie! What Should Be Anger Leads To A Desire To Get Her Pussy Fucked And Then Confess Everything! Wife With A Perfect Ass, Mai-san (34 Years Ol

  • censoredmarried womanblowjobDANDANdandyDANDAN-014DANDAN0141dandan00014
    • 2021-09-11
    130 min

    [CEMD-054]I Raised A Sexual Relief Doll To Do As I Want, Vol. 5 Yui Hatano

  • yui hatano censoredcreampiemature womanCEMDserebu no tomoCEMD-054CEMD054cemd00054
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-18
    150 min

    [FCDC-135]Slutty Secretary Seduces Employees With Big Butt And Tits Airi Takasaka

  • airi takasaka censoredslutsingle workFCDCweekenderFCDC-135FCDC135fcdc00135
    • 2021-09-24
    118 min

    [HMN-039]Newbie: I Blame You For Shogi But I Want To Be Blamed For Sex! Former Shogi Club Chief Creampie AV DEBUT! Ryohana Mitsushima

  • ryoka mitsushima censoredcreampieuniformHMNhonnakataiga kosakaiHMN-039HMN039hmn00039
    • 2021-10-02
    51 min

    H4610 ki211003 Naoko Imokawa

  • amateur uncensoredh4610
    • 2021-10-08
    200 min

    [HUNTB-109]I"m The Only Guy In The New Apartment Building That I Moved Into, And The Other Residents Are All Beautiful And Slutty Girls. 24 Hours A Day They Go Straight For My Dick In A Sperm-covered Creampie Orgy...

  • censoredcreampieblowjobHUNTBhunterkonnyaku kannohhh groupHUNTB-109HUNTB109huntb00109
    • 2021-10-16
    240 min

    [AVSW-061]AIKA"s World, 4 Hours of Her BEST Stuff

  • aika censoredsingle workAVSWavsAVSW-061AVSW061avsw00061
    • 2021-10-18
    76 min

    530DG-016 ＃ 04 Female College Students Who Are Abandoned On The Emergency Stairs Of The Building At The New Welcome Party And Fall Asleep

  • amateur censoredcreampiebig titsdgdg-016dg016530dg-016
    • 2021-11-05
    167 min

    [DVDMS-731]Formet Entertainer Mika Kisaragi [Creampies Unleashed] Before Her Husband... Secret Creampie Meeting On Her Ovulation Day

  • mika kisaragi censoredcreampiesingle workDVDMSdeepsbiba gonzoDVDMS-731DVDMS731dvdms00731
    • 2021-11-05
    149 min

    [JUL-759]With A Cool Face, My Underwear Are Always Sopping Wet. Rie Suimitsu, 27 Years Old AV DEBUT

  • water honey rie censoredmature womansingle workJULmadonnamamezawa mametarouJUL-759JUL759jul00759



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online