big tit shaved jav censored javcensored




FC2SPRDDASDAVSALULUKBIBBANMIDVBLKDTTAWDSSNIMARAMVSDSTARSFSDSSEBODHNDSHKDROYDDASD

2020-10-15
78 min

[mgmr-127]MEARI(26)

  • amateur censoredamateurbeautiful girlmgmrmgmr-127mgmr127mgmr-127
    • 2020-10-22
    51 min

    [h0930-ki201022]品川 亜由子 48歳

  • amateur uncensoredh0930
    • 2020-10-24
    63 min

    FC2PPV 1544828 [Completely hidden shooting] No outflow! With a small camera installed, the whole story of vaginal cum shot from raw squirrel negotiations is released to a business trip Menes beauty older sister

  • amateur uncensoredfc2
    • 2020-10-28
    80 min

    107HISN-014 [Distribution Exclusive] SOD Rookie AV Debut Ikoma Miku (21) T: 163 B: 89 (F) W: 62 H: 85

  • amateur censoredamateurhisnhisn-014hisn014107hisn-014
    • 2020-11-06
    119 min

    [JLZ-048]A Mature Woman Lesbian A Snack Bar Mama And A Building Owner Oh, You Can't Pay The Rent？ Noriko Yada Yukie Mizukami

  • noriko yada yukie mizukami censoredmature womanJLZrubykoji tsujikuroyuriJLZ-048JLZ048jlz00048
    • 2020-11-06
    70 min

    415LAS-029 Saanasan

  • amateur censoredcreampiebig titslaslas-029las029415las-029
    • 2020-11-12
    160 min

    [DANDY-737]A Nurse With A Beautiful Ass Is Giving Some Cowgirl Care To A Man Who Has An Erection But Cannot Move While She Grinds Him In S-Curve-Shaped Thrusts vol. 4

  • yuri fukada sea sky flower censoredslutnurseDANDYdandybacon tanakaDANDY-737DANDY7371dandy00737
    • 2020-11-12
    196 min

    [PIYO-093]These Young Bitches Decided To Spread Their Wings A Bit During The School Trip, And They Told Me They Loved Me That Summer, As Our Relationship Turned Into A Sexual Harlem

  • censoredcreampieschoolgirlPIYOhyokopiero dabicchiPIYO-093PIYO0931piyo00093
    • 2020-11-12
    129 min

    [GUN-844]Mature Woman In Sailor Uniform - Embarrassing Stain On Her Panties: Ai Shinkawa 7

  • aishin shinkawa censoredmature womansingle workGUNradixshio sakurababatsugun paradoxGUN-844GUN844433gun00844
    • 2020-11-13
    67 min

    259LUXU-1333 Luxury TV 1326 Its appearance is just a goddess! Nozomi Makita, a hotel front lady who is too beautiful, is back! It seems that frustration has been refined for the first time in the previous work to have sex. A sexually hungry beauty de

  • amateur censoredamateurluxuluxu-1333luxu1333259luxu-1333
    • 2020-11-13
    170 min

    [JUFE-226]Big Booty Slut Seduces You With Her Dirty Talk Into Fulfilling Her Every Carnal Whim - Extreme POV Angles JOI Hijiri Maihara

  • kiyoshi maihara censoredslutJUFEfitchyumeno aidaJUFE-226JUFE226jufe00226
    • 2020-11-16
    81 min

    [SHN-064]Sensual (Shameful) Big Tits Pervert 2020 School Swimsuit Girl (Est. E-Cup) / Track-And-Field Girl (Est. F-Cup)

  • censoredbig titssquirtingSHNnatural highkansukenatsu carefully selected daughterSHN-064SHN0641shn00064
    • 2020-11-26
    121 min

    [GS-365]The Girl At My Favorite Bar Is The Stepdaughter Of The Proprietress But She's Way Too Hot Not To Fuck - She Services Me On The Down Low.

  • censoredGSsosoru x garconspada ikebukuroGS-365GS365h-101gs00365
    • 2020-11-28
    300 min

    [MCSR-415]Extremely Lewd Apartment Wives - 50 People, 5 Hours

  • ryo hanasaki kazama yumi censoredbig titsMCSRbig morkaljiro kanekomascottMCSR-415MCSR41557mcsr00415
    • 2020-12-08
    82 min

    300NTK-469 Visit the hospital to find out what the cause and effect of 170cm beauty G milk OL is! !! The iron plate that I was born with is a raw spit! !! Even a dirty metamorphosis practitioner forgets the preciousness of loving beautiful limbs! !!

  • amateur censoredbig titsamateurntkntk-469ntk469300ntk-469
    • 2020-12-21
    300 min

    [MANN-028]ERIKA Premium BEST 5 Hours

  • erika moka censoredcreampiebig titsMANNmangetsu mousouzokufull moonMANN-028MANN028mann00028
    • 2021-01-08
    41 min

    [NTTR-058]Possessed For One Minute But I Ravished Her 13 Times! With This Spell, I Can Take Over Her Body And Make Her Fuck Me! Over And Over Until This Naughty, Beautiful Teen Is Thoroughly Enjoyed - Inside And Out! Ichika Matsumoto

  • ichika matsumoto censoredNTTRsod createslowly fujinoknotriNTTR-058NTTR0581nttr00058
    • 2021-01-23
    309 min

    [FTOM-002]POV With Amateurs Found Via SNS: Shaved Pussy Amateurs, 4 People, 5 Hours Special

  • censoredamateurblowjobFTOMfuutubeakiba masatoamateur gonzo circleFTOM-002FTOM002h-1068ftom00002
    • 2021-01-23
    120 min

    [JBJB-019]ドM願望あるバイリンガル美女は初めてのおじさんとのSEXでたっぷり体液交換しちゃいました！ 望月りさ

  • risa mochizuki censoredsingle workJBJBsharkjabujabu machiJBJB-019JBJB019h-687jbjb00019
    • 2021-02-13
    76 min

    200GANA-2435 Seriously Nampa, first shot. 1597 Succeeded in picking up a female college student with a plump body who is worried about big ass! Take me to the hotel to help with body makeup and start touching on the training equipment ♪ Good quality

  • amateur censoredbig titsamateurganagana-2435gana2435200gana-2435
    • 2021-02-19
    153 min

    [TSF-014]You're A Male College S*****t Who Loves Betting On Horse Races, But When You Wake Up In The Morning, You Find Out That You've Been Transformed Into A Girl (23) A Thorough Investigation "Seriously, I'm A Guy" But She Could

  • todo hayama censoredcreampieuniformTSFkaguyahimept mousouzokugynecomastia reportTSF-014TSF014tsf00014
    • 2021-02-22
    108 min

    [HAHOB-026]Akasaka Working Girl Dental Assistant Non-Nude Erotica! Uji Hitomi Hara

  • censoredbig titsbeautiful girlHAHOBintecHAHOB-026HAHOB026h-706hahob00026
    • 2021-02-26
    51 min

    [ETQR-201](Daydream POV) Creampie Sex With A Beautiful Girl In A Sailor Uniform Hikari 03

  • censoredcreampieuniformETQRerotic timeETQR-201ETQR201h-1186etqr00201
    • 2021-02-27
    76 min

    300MAAN-629 [Ultimate Saseko Advent] An ideal extreme erotic BODY that you can’t think of as neat (self-proclaimed)! Bubble ass job play to play with each other in the bath! Unique to soft girls! Adhesion etch in an impossible position! !! Super

  • amateur censoredcreampieamateurmaanmaan-629maan629300maan-629
    • 2021-02-28
    135 min

    [KTKL-095]Face-Fucking - Putting My Big-Titted Pet Up For Rent: As Many Creampies As You Want For 0 Yen! Hazuki

  • censoredcreampiebig titsKTKLkitixx mousouzokuloliconKTKL-095KTKL095ktkl00095
    • 2021-03-03
    150 min

    [PFES-006]Married Secretary's Exposed Thighs Boss Humiliates Celibate Wife In The Office Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanPFESmadonnajotaro tomisummer panties festivalPFES-006PFES006pfes00006
    • 2021-03-18
    161 min

    [DVDMS-645]Hungry, Insatiable, Dick-Sucking, Lust-Filled Sex That Goes On And On Until My Balls Are Drained Dry Unsatisfied With Just Creampie Sex, She's Using Her Mouthpussy To Beg For More Semen With A Follow-up Blowjob Maya Hongo

  • hongo maya censoredcreampiebig titsDVDMSdeep seightDVDMS-645DVDMS645dvdms00645
    • 2021-03-23
    242 min

    [SHIC-206]Tiny Teens 11 Girls 4 Hours

  • amateur censoredbeautiful girlSHICadolscence.comSHIC-206SHIC206
    • 2021-03-24
    62 min

    SIRO-4467 [First shot] [Professional student injured] [Begging with a shameful face] "I can’t even watch a romance movie .." 20-year-old young body is an adult technique .. AV application on the net → AV experience shooting 1490

  • amateur censoredsquirtingamateursirosiro-4467siro4467siro-4467
    • 2021-03-27
    45 min

    [PSST-025]Slutty Cougar Spotted In Hungary! Wild Blonde MILF Wants Cock - Her Raw Porn Debut! Blowjob-Hungry Mature Babe Wants To Suck Your Dick More Than She Wants Food! Tia Blonde

  • tear blonde censoredamateurPSSTpatzkin amateurbooker tPSST-025PSST025h-1450psst00025
    • 2021-04-09
    140 min

    [SKEJ-008]Moaning With Ecstasy! Beautiful Girl Gets Pounded Hard By Huge Cock!

  • censoredamateurbeautiful girlSKEJamateur time delusion groupSKEJ-008SKEJ008skej00008
    • 2021-04-10
    56 min

    10musume 041021_01 The Structure Of Woman : Measuring Size of Freaky Body Parts Miho Saeki

  • amateur uncensored10musume
    • 2021-05-06
    92 min

    [KAAD-053]My Beautiful Mother-in-Law Akiko Izumi

  • ryoko izumi censoredcreampiemarried womanKAADcenter villagejiro fukagawahanazono center villageKAAD-053KAAD053h-086kaad00053
    • 2021-05-14
    240 min

    [HUNTB-013]I'm Together With My C***dhood Friend, And We're Playing A Private Game Of Truth Or Dare! We Always Liked Each Other, But Because We Were Always Together, We Could Never Tell Each Other That, And So We Continued With This Weird Rel

  • censoredschoolgirlHUNTBhunterkawajirihhh groupHUNTB-013HUNTB013huntb00013
    • 2021-06-08
    140 min

    [SDNM-288]Hot Elder Care Nurse Miyu Kurita, Age 28, Chapter 3 - She's Never Let Her Husband See Her Fucked Quite Like This - Seductive Slut Rides Other Men's Rods

  • miyu kurita censoredblowjobmature womanSDNMsod creategenuine married woman the porn experienSDNM-288SDNM2881sdnm00288
    • 2021-06-12
    243 min

    [NSFS-001]Crying Temptation Miho Tono Best

  • miho tsuno censoredmarried womanmature womanNSFSnagae stylesano b sakutomi taketaroNSFS-001NSFS001nsfs00001
    • 2021-06-17
    124 min

    [KAGP-186]Extreme Orgasm Oil Massage - 10 Women - Talented Massage Girls Drain The Cum From Your Balls! 4

  • censoredhandjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-186KAGP186kagp00186
    • 2021-07-14
    245 min

    [DVDMS-691]Picking Up MILFs While Their Husbands Are Away! Young MILFs Dropping Their K*ds Off At Daycare! Would You Like To Play Truth Or Dare With A Male Virgin？ It's Been Ages Since Their Husbands Have Fucked Them, And They're Horny! Cream

  • censoredcreampiebig titsDVDMSdeepsiwanagadeep sDVDMS-691DVDMS691dvdms00691
    • 2021-07-19
    62 min

    FC2PPV 1929536 Limited To 300 [Uncensored] Bakery Signboard Girl Jd ・ This Is The First And Last ・ Anal Development Of Big Butt (* 60 Minutes Inserted In The Review)

  • amateur uncensoredfc2
    • 2021-07-20
    61 min

    1Pondo 072021_001 Experience Anal SEX for the first time! Kurumi Tokito

  • amateur uncensored1pondo
    • 2021-08-06
    63 min

    SIRO-4574 [First Shot] [Blow Job With A Horny Sound] [Amazing Continuous Iki] An Active JD With A Wonderfully Cute Shy Reaction. The Body On The Verge Of An Outburst That Has Been Overtaken By Masturbation Exposes Continuous Death Many Times .. Appli

  • amateur censoredamateursirosiro-4574siro4574siro-4574
    • 2021-08-28
    240 min

    [JKSR-508]Taking It Again And Again With Big Vibrator And Vibrator! Married Women Shout With Pleasure While Taking A Dildo In Bed, 26 Performers, 4 Hours

  • censoredmarried womanamateurJKSRbig mocalobockeypink junkieJKSR-508JKSR50857jksr00508
    • 2021-08-31
    103 min

    261ARA-504 [Osabori Ol] [Mask Beauty] Sakura-Chan Is Here! !! The Reason For Applying For A Beautiful Girl Is "I Want To Suck My Cock ♪" I Skipped Work And Came To AV Shooting ♪ I’M Too Embarrassed To Remove The Mask To The Last Minute!

  • amateur censoredamateuraraara-504ara504261ara-504
    • 2021-09-02
    65 min

    200GANA-2546 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Secret Shooting 217 When I Brought A Cute Adult Sister Who Works At Jakuso To My House, I Shake My Soft Boobs (Estimated F Milk) And Roll It Up! It Was A Full-Fledged Gir

  • amateur censoredbig titsamateurganagana-2546gana2546200gana-2546
    • 2021-09-02
    61 min

    326NKD-002 [Creampie Tracking 24:00] Over 40 Experienced People! ？？ Natural Spear Man Appeared! !! Once You Eat It, You Won’t Let Go Of It Until You Cum Inside It! !! [Case: 02 / Darkness Of Club Street]

  • amateur censoredcreampieamateurnkdnkd-002nkd002326nkd-002
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online