bra




FC2HODVAUKSRBDHDKASANHZGDNACXFSDSSPPPDJUFENACRADNMIAAMEYDNATRDASDAWDSSNIPREDSPRD

2020-09-18
184 min

[DOCP-247]Careless College Girl Living Alone Walks Around Without A Bra Without Even Shutting The Door - A Single Cock Rubbed Up On Her From Behind Is Enough To Drive Her Wild - Drilled To Intense Orgasms, She Takes Creampie After Creampie!

  • himari kinoshita wakamiya censoredcreampiebeautiful girlDOCPprestigedoc premiumDOCP-247DOCP247118docp00247
    • 2020-09-17
    119 min

    [SSNI-871]No Bra J-cup: I Am The Worst, I Lose Out To The Unrealized Temptation That My Girlfriend's Big Titted Younger Sister Is Giving Off - Mei Washio

  • mei washio censoredbig titssingle workSSNIs1 no 1 styletiger kosakaiSSNI-871SSNI871ssni00871
    • 2020-09-16
    240 min

    [RVH-003]Desperate Wives Go Hunting The Dick Next Door- Without Underwear On! BEST Collection vol. 1

  • yui hatano hasumi claire censoredslutRVHglory questRVH-003RVH00313rvh00003
    • 2020-09-16
    56 min

    345SIMM-513 [Voyeurism] No Bra A Young Lady J ○ Who Is Licked All Over Her Body During A Nap And Gets Vaginal Cum Shot

  • amateur censoredcreampieuniformsimmsimm-513simm513345simm-513
    • 2020-09-02
    63 min

    [KBTV-019]If She's Wearing No Bra Or Panties Under Her Yukata At The Festival, Can You Fuck Her Quicker？ Theory

  • censoredamateurKBTVmessy tvKBTV-019KBTV019h-1514kbtv00019
    • 2020-09-02
    120 min

    [GVH-118]The Wife Who Moved Next Door Teases Me With No Bra And No Panties! Saya Minami

  • minami saya censoredslutsingle workGVHglory questyellow cherry vaseGVH-118GVH11813gvh00118
    • 2020-09-01
    59 min

    Pacopacomama 090120_352 No bra temptation Reina Nanjyo

  • reina nanjyo uncensoredcreampieblowjobpacopacomama
    • 2020-08-21
    412 min

    [GOAL-031]17 Married Woman Who Throw Away The Trash Without A Bra On - Chest Voyeur 7 Hours

  • censoredGOALprestigegoalGOAL-031GOAL031118goal00031
    • 2020-08-18
    59 min

    Caribbeancom 081820-001 No-bra Wife In The Morning: Maiko Saegimi

  • maiko saegimi uncensoredcreampiehandjobcaribbeancom
    • 2020-08-15
    219 min

    [HUNTA-836](No Bra + Camisole) x A Big Tits Big Stepsister = I Can Bury My Face Into Her Suffocatingly Big Tits And Cum As Much As I Want, Right!？

  • censoredcreampiebig titsHUNTAhuntercognac kaminohhh groupHUNTA-836HUNTA836hunta00836
    • 2020-08-14
    157 min

    [BAZX-243]A No Bra Flat Chested Private Tutor Flashes Nip Slip Special Lessons Mitsuki Nagisa Aida Usagi Rin Fujisawa

  • scooping aika usagi censoredcreampiebeautiful girlBAZXbazookatodoBAZX-243BAZX243h-1496bazx00243
    • 2020-08-13
    230 min

    [AKDL-040]No Bra, Visible Nipples - Keep Teasing These Girls Until Their Nipples Get Hard And Their Hips Will Start To Move Too As They Lose Themselves To Pleasure

  • honoka wakamiya yuri fukada censoredbig titsAKDLaquinoriaquinoriaknrAKDL-040AKDL0401akdl00040
    • 2020-08-13
    195 min

    [SW-720]These Big Ass No Bra Nip Slipping Horny Young Wives Are Pretending To Help Me And My Brother, But Are Actually Luring Us To Temptation!？ They Were Just Using Us To Satisfy Their Sexual Desires!!

  • censoredSWswitchcambridgeswitch switchSW-720SW7201sw00720
    • 2020-08-05
    120 min

    [GVH-104]No Bra, No Panties: Newly Moved In Lecherous Housewife Next Door Comes On To Me! Mao Hamasaki

  • hamazaki mao censoredslutsingle workGVHglory questkabin kizakuraGVH-104GVH10413gvh00104
    • 2020-07-24
    61 min

    417SRCN-022 Hcup Sensitive erotic big breasts flirting ♪ If you want to show a no bra big tits wife while picking up a car, you can not believe it! Too erotic and convulsive obscene body and squirting whole body & endless! Flooding the strongest

  • amateur censoredcreampiebig titssrcnsrcn-022srcn022417srcn-022
    • 2020-07-17
    48 min

    [ETQR-150][Daydream POV] Nipple Peeping No Bra Private Tutor Rin Fujisawa

  • rin fujisawa censoredcreampiebeautiful girlETQRerotic timeETQR-150ETQR150h-1186etqr00150
    • 2020-07-17
    55 min

    [ETQR-148][Daydream POV] Nipple Peeping No Bra Private Tutor, Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlETQRerotic timeETQR-148ETQR148h-1186etqr00148
    • 2020-07-17
    49 min

    [ETQR-149][Daydream POV] Nipple Peeping No Bra Private Tutor Aida Usagi

  • aika usagi censoredcreampiebeautiful girlETQRerotic timeETQR-149ETQR149h-1186etqr00149
    • 2020-07-16
    149 min

    [ROYD-015]"Wow, Are You Wearing A Black Bra Today, Teacher？" My Private Tutor Is A Hot Babe Who Got Caught In A Rainstorm On Her Way Over. Soaked To The Skin, Her Clothes Turned Totally See-Through And I Can't Take It Anymore... Kaede Ito

  • kaede ito censoredcreampiebig titsROYDroyalkawajirihhh groupROYD-015ROYD015royd00015
    • 2020-07-10
    90 min

    345SIMM-461 Town Bra → Meals → Love Hoin! Big Tits! Beautiful Breasts! Nice Ass! Smooth And Smooth Perfect J ○! Embarrassing Home Masturbation Unveiled By Uncle’S Instructions! Two Consecutive Ejaculations To A Cute Ubu Girl Who Trembles And Wri

  • amateur censoredcreampieuniformsimmsimm-461simm461345simm-461
    • 2020-07-09
    125 min

    [FSDSS-065]The Girl Next Door Never Wears A Bra And I Can See Her Nipples - She Seduces Me While Her Boyfriend Isn't Looking - Suzume Mino

  • suzume mino censoredbig titsslutFSDSSfalenofaleno starFSDSS-065FSDSS0651fsdss00065
    • 2020-07-08
    120 min

    [GVH-087]A Slutty Wife With No Bra And No Panties Moved In Next Door To Provoke Me! - Miho Tono

  • miho tsuno censoredslutsingle workGVHglory questkabin kizakuraGVH-087GVH08713gvh00087
    • 2020-06-27
    180 min

    [CLUB-614]A Stay-At-Home Wife Uses No-Bra Temptation To Have Sweaty Sex While Her Husband Is Away 2

  • censoredcreampiebig titsCLUBhentai gentleman clubCLUB-614CLUB614club00614
    • 2020-06-05
    122 min

    [UMD-737]What？! My Friend's Girlfriend Is Hiding In My Bed？! - "Do You Want To Have Sex With Me？ Nobody Can See Us If We Do It Between The Sheets..." 2

  • kanon kanon yuri fukada censoredblowjobUMDleodragon nishikawaUMD-737UMD737125umd00737
    • 2020-05-21
    121 min

    [DAYD-037]I'm A Private Tutor During The Day, I Get Lured To Temptation By My S*****ts And Fucked, And I Spend My Time Luxuriating in A Dream-Cum-True Fantasy While Being Transported By Their Erotic Fragrances... Kanon Ichikawa

  • kanon ichikawa censoredcreampiebeautiful girlDAYDadolescence.comadolescent fiction daydreamDAYD-037DAYD037h-839dayd00037
    • 2020-05-15
    244 min

    [DOCP-224]Front Closure Bra Temptation 4 I Was Peeping On The Big Tits Beauty Who Lived Across From me, And I Could Tell That She Was Bashfully Removing Her Bra, And Starting To Lure Me To Temptation... I Lost My Mind, And Allowed Her To Tempt Me As

  • sea sky flower chinatsu hashimoto censoredbig titsDOCPprestigedoc premiumDOCP-224DOCP224118docp00224
    • 2020-05-08
    117 min

    [GS-330]Afternoon Sex With A Braless Big Tits Young Wife That Feels Way Too Good! I Always Pass By This Young And Pretty Wife In The Hallway, But She's So Sexy That I Could Never Look Her In The Eye. But Today, She's Walking Around Without He

  • censoredbig titsGSsosoru garconred ballGS-330GS3301gs00330
    • 2020-05-01
    120 min

    [UMD-732]Alone With My Female Boss I Long For... 5

  • mitani akari hasumi claire censoredUMDleodragon nishikawaUMD-732UMD732125umd00732
    • 2020-04-27
    120 min

    [SHIC-136]My Stepdaughter Doesn't Wear A Bra At Home, And As Her Stepfather, I Have A Problem With That... Himari-chan

  • ogawa himari censoredbeautiful girlSHICcomSHIC-136SHIC136
    • 2020-04-23
    120 min

    [SW-699]Not Only Does She Have Big Tits, She Never Wears A Bra, So Her Titties Are Jiggling And Wiggling And I Can See Them And I Can't Take My Mind Off Of It, And She's Wearing Knee-High Socks And That Total Domain Of Eroticism Is So Allurin

  • censoredbig titsSWswitchswitch switchSW-699SW6991sw00699
    • 2020-04-23
    49 min

    [GRCH-369]Trapped Investigator IV: A Requiem For You Part 2: Using Brainwashing Mist To Destroy Her Mind And Bring Her To Threeway Climax Hell

  • hasumi claire kanna misaki censoredGRCHgirl s chkei morikawaGRCH-369GRCH3691grch00369
    • 2020-04-10
    126 min

    [GZAP-022]This Horny Housewife From The Neighborhood Is Washing Her Car Without Her Bra On, So I Soaked This Vibrator In Aphrodisiacs And Shoved It Into Her Cunt And Strapped It On Tight!! She Was Tied Up And Exposed Outdoors With Big Sweet Potato Ap

  • censoredGZAPprestigesapGZAP-022GZAP022118gzap00022
    • 2020-04-04
    185 min

    [HUNTA-754]Her Blouse Is 200 Transparent, And I Can See Her Bra, And I'm Having Trouble Concentrating In The Classroom! While Going To School, We Got Caught In A Sudden Rainstorm, And Now All The Girls Are Soaking Wet, And I Can See Their Bras Th

  • censoredcreampieschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-754HUNTA754hunta00754
    • 2020-04-01
    120 min

    [GVH-055]This Horny Housewife Who Doesn't Wear Bras Or Panties Has Moved In Next Door And Is Trying To Tempt Me! Rio Yukino

  • yukino censoredslutsingle workGVHglory questkabin kizakuraGVH-055GVH05513gvh00055
    • 2020-03-27
    59 min

    FC2PPV 1315787 [Uber Girls] Muscle Sharpness 23♀! No Bra No Panties Rumored In The Streets Bring In A Too Cute Uva Woman And Seed Sex! Orgy Gonzo With Everyone [Amateur / Orgy / Personal Shooting] [cen]

  • amateur uncensoredfc2
    • 2020-03-14
    240 min

    [HUNTA-740]"Oh No, I'm All Wet!" - "Ha Ha Ha! I Can See Your Bra!" - "I Can See Yours Too!" - My Stepsister And Her Friends Get Tipsy And Get Soaking Wet...

  • censoredcreampielingerieHUNTAhuntermorikihhh groupHUNTA-740HUNTA740hunta00740
    • 2020-03-12
    124 min

    [GS-318]Double-Booked With A Slut - I Booked A Cheap Room Online To Save On My Travel Expenses, But After I Arrived, A Cute Girl Checked Into The Same Room! - It Seems Like The Room Was Double-Booked, But Neither Of Us Are Going To Leave... I Can See

  • censoredGSsosoru garconspader ikebukuroGS-318GS3181gs00318
    • 2020-03-08
    129 min

    [IPX-453]A Private Tutor With No Bra Accidentally Seduces Her S*****t - Kana Momonogi

  • kana momonogi censoredbig titsbeautiful girlIPXidea pocketdragon nishikawadishIPX-453IPX453ipx00453
    • 2020-03-04
    120 min

    [GVH-039]A Sexy Wife Who Never Wears Bras Or Panties Just Moved Next Dear And She's Looking For Action! Kana Morisawa

  • kana morisawa kanako iioka censoredslutsingle workGVHglory questkabin kizakuraGVH-039GVH03913gvh00039
    • 2020-02-29
    178 min

    [CLUB-609]A Stay-At-Home Wife Uses No-Bra Temptation To Have Sweaty Sex While Her Husband Is Away

  • censoredcreampiebig titsCLUBhentai shinshi clubno directorCLUB-609CLUB609club00609
    • 2020-02-28
    60 min

    [PARATHD-2806]We Nampa Seduced These Nip Slipping No-Bra Girls We Saw On The Street (2)

  • amateur censoredamateurPARATHDparadise tvPARATHD-2806PARATHD2806
    • 2020-02-22
    65 min

    300NTK-315 Secure A Flashy Yoga Bra E Cup Beauty Yogi! !! Plump clitoris that insists even on leggings that bite into the nice ass tightly is a weak point of stringing sensitive maco! !! 180 ° wide open leg SEX that makes use of yogi’s soft body

  • amateur censoredcreampieamateurntkntk-315ntk315300ntk-315
    • 2020-02-21
    60 min

    [PARATHD-2805]We Nampa Seduced These Nip Slipping No-Bra Girls We Saw On The Street (1)

  • amateur censoredbig titsamateurPARATHDparadise tvPARATHD-2805PARATHD2805
    • 2020-02-15
    172 min

    [PPPD-829]My Stepsister Doesn't Wear A Bra - Her Innocent Tits Are Calling Me - Ena Koume

  • ena koume censoredbig titssisterPPPDoppaino directorPPPD-829PPPD829pppd00829
    • 2020-02-14
    151 min

    [SCOP-662]This Married Woman Was Carelessly Taking Out The Garbage Without Her Panties And Bra On, And I'm A Cherry Boy. She Knew That I Was Spying On Her, And Then She Started Flashing Her Tits And Pussy At Me On Purpose! And Not Only Did She Fl

  • censoredcreampieslutSCOPscoopkuwattimousouzokuSCOP-662SCOP662h-565scop00662
    • 2020-02-07
    122 min

    [UMD-721]I Got Lucky To See Some Nip Slips And Kept Watching In The Hopes Of Not Getting Caught, But Maybe She Saw Me Anyway!？ 13 - The Yoga Instructor -

  • mitani akari yano tsubasa censoredsluthandjobUMDleodragon nishikawaUMD-721UMD721125umd00721



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online