censored high vision older sister jav javcensored




FC2SSNINATRWAAAFSDSSATIDMEYDSSISVENXROYDHMNHUNTBCHRVVENUWANZGVHSQTESPRDSTARSCESDSHKD

2018-11-22
135 min

[STARS-006]Suzu Honjo Obedience Breaking In Training With A Beautiful Cabin Attendant In The Room Of A High-Class Hotel

  • suzu honjo censoreduniformsingle workSTARSsod createmichiru arashiyamasod starSTARS-006STARS0061stars00006
    • 2018-11-22
    133 min

    [STAR-942]Mana Sakura Brothers Pretend To Be Cherry Boys And Fuck Their Sister's Friend. Multiple Creampies. Convulsive Orgasms.

  • mana sakura censoredcreampiebeautiful girlSTARsod createkogoro kindaichisod starSTAR-942STAR9421star00942
    • 2018-11-18
    97 min

    [ONIN-039]Girls In Figure-Hugging Loungewear. Pull Down Her Sweatpants And Bang Her Voluptuous Ass!

  • censoredONINtamanegi mousouzokudoryu barrymoretamanegiONIN-039ONIN039onin00039
    • 2018-11-18
    119 min

    [ONIN-038]A Former Member Of The Track And Field Club. She Doesn't Compete Anymore But Her Body Is Still Toned. We Made Her Wear The Gym Shorts She Used To Wear For Competitions!

  • censoredONINtamanegi mousouzokudoryu barrymoretamanegiONIN-038ONIN038onin00038
    • 2018-11-17
    116 min

    [PPPD-713]My Girlfriend's Big Sister Tempts Me With Her Big Tits And By Her Willingness To Get Creampied. Riri Hosho

  • hosei lily censoredcreampiebig titsPPPDoppaiupdatingPPPD-713PPPD713pppd00713
    • 2018-11-17
    120 min

    [PPPD-711]Tied Up By A Busty Literary Girl And Made To Cum Continuously. JULIA

  • julia censoredcreampiebig titsPPPDoppaiPPPD-711PPPD711pppd00711
    • 2018-11-17
    239 min

    [GAPL-045]I Was Giving This Girl With A Big Ass And Hot Pants A Crotch Massage, But She Was Trying To Lure Me To Temptation... And Then She Started Flooding My Table With Her Pussy Juices And Wriggling Her Ass In Ecstasy. She Slut Fucked Me, And Even

  • censoredcreampieslutGAPLgreen applehhh groupGAPL-045GAPL045gapl00045
    • 2018-11-16
    240 min

    [ABP-798]Saki Oto's Ultimate Cherry Popping Fuck 24 An Amazing Cherry Boy Popping Cowgirl!

  • ototo sakino censoredanalblowjobABPprestigepiero daabsolutely perfectABP-798ABP798118abp00798
    • 2018-11-11
    91 min

    [VENU-829]My Wife's Big Sister Suddenly Came Over And Kept On Fucking Me For 2 Days And 1 Night Yumi Kazama

  • kazama yumi censoredcreampiemature womanVENUvenussaruincest winntersVENU-829VENU829venu00829
    • 2018-11-10
    154 min

    [IPX-224]She Takes Advantage Of The Young Lust Of Her Naive Students. The One-On-One Lessons On Temptation With Miss An, The Nymphomaniac Teacher. An Hinohara

  • an hinohara censoredslutsingle workIPXidea pockettake ddishIPX-224IPX224ipx00224
    • 2018-11-10
    157 min

    [IPX-223]"Look At My Tits..." The Temptation Of A Bra-Less Young Lady With Colossal Tits Spilling Out Of Her Clothes. For The Boob Fetishists! Hard-Ons Guaranteed! 6 Hot Situations. The Girl With The J-Cup, 100cm Tits Flashes Her Assets... Mi

  • miasaka mia censoredbig titssingle workIPXidea pocketinaballdishIPX-223IPX223ipx00223
    • 2018-11-10
    145 min

    [IPX-226]"I Already Came! Stop It!" Continuous, Relentless Fucking After An Orgasm. Relentlessly Fucking A Pussy That Just Came And Forcing Her To Have Another Orgasm! Tsubasa Amami

  • amami tsubasa censoredbig titssquirtingIPXidea pocketkahori maedanodishIPX-226IPX226ipx00226
    • 2018-11-10
    136 min

    [RHE-616]This Handjob Angel Will Look Into Your Eyes As She Throttles Your Cock She's Embarrassed But This Amateur Babe Will Stare Into Your Eyes While She Does It!

  • censoredamateurblowjobRHEhot entertainmentmamorudish the fetishRHE-616RHE61659rhe00616
    • 2018-11-10
    120 min

    [MIAE-321]Sticking A Vibrator Covered In Aphrodisiac In A Young Lady With A Big Ass, With Her Asshole Fully Exposed!! We Leave Her Alone Until She Orgasms Yu Shinoda

  • shinoda yu censoredbig titssingle workMIAEmoodyzk westmoodyz acidMIAE-321MIAE321miae00321
    • 2018-11-10
    115 min

    [MIAE-335]Ever Since My Senpai From The Literature Club Who's A Year Older Than Me Took My Virginity, She's Been Raping Me For 3 Years... Nao Jinguji

  • jinguji temple nao censoredbeautiful girlslutMIAEmoodyzhiroamoodyz acidMIAE-335MIAE335miae00335
    • 2018-11-10
    197 min

    [IPX-225]Back By Popular Demand!! The Titty-Touching Pub Where You Can Go All The Way 2 & We Sneak Into A Titty-Touching Pub IRL And Have Real Sex. 2 Titles. 4 Sex Scenes. Momo Sakura

  • sakura sky momo censoredbig titssingle workIPXidea pocketzaku araidishIPX-225IPX225ipx00225
    • 2018-11-09
    119 min

    [MDB-955]Fully Naked Office Lady Harlem Special Aya Miyazaki Tsubasa Hachino Mihina Nagai Saki Mizumi

  • aya miyazaki yano tsubasa censoredMDBmedia stationtaro shizuka wabazookaMDB-955MDB95561mdb00955
    • 2018-11-09
    163 min

    [MDB-958]A Beautiful Big Tits Japanese Lady Provides Ultra High Class Sexual Health Hospitality Services

  • kirishima sakura maria serizawa censoredcreampiebig titsMDBmedia stationkuwattibazookaMDB-958MDB95861mdb00958
    • 2018-11-09
    150 min

    [SCOP-565]If I Rub My Erect Dick Against The Ass Of A Slutty And Bossy Office Lady Who Keeps Taunting Me By Flashing Her Panties, Will She Let Me Fuck Her？

  • censoredcreampieSCOPscoopkitorune kawaguchimousouzokuSCOP-565SCOP565h-565scop00565
    • 2018-11-09
    242 min

    [MKMP-249]The Hall Of Fame! Super Idol 4 Hours Yuri Oshikawa

  • yuri sugawa censoredcreampiebig titsMKMPk m producefusaemonmillionMKMP-249MKMP24984mkmp00249
    • 2018-11-09
    132 min

    [XRW-591]Mind Blowing! A Dirty Talk Handjob

  • yui aoba chihiro akino censoredblowjobslutXRWreal worksreal real worksXRW-591XRW591172xrw00591
    • 2018-11-08
    128 min

    [STAR-996]Controlling The Weather Girl With The Hypnotism Beam. Masami Ichikawa

  • masami ichikawa censoredsingle workdramaSTARsod createeasy matsumotosod starSTAR-996STAR9961star00996
    • 2018-11-04
    115 min

    [BLOR-107]A Young Lady Who Works In A Roadside Station. A Country Girl Who Speaks In A Dialect Is Enraptured By The Pleasure Of Loving Sex!

  • censoredBLORbroccoli mousouzokubroccoliBLOR-107BLOR107blor00107
    • 2018-11-03
    119 min

    [SSNI-340]My Girlfriend's Busty Sister Who Seduces Me With Her Bra-less Tits And Me, The Loser Who Gives Into The Temptation. Shunka Ayami

  • ayami shunka censoredbig titssingle workSSNIs1 no 1 stylezampaSSNI-340SSNI340ssni00340
    • 2018-11-03
    218 min

    [HUNTA-512]This Cabin Attendants' Dorm Has A Male Prohibition Policy And These Beautiful And Horny Ladies Are Starving For Sex, And I'm The Only Man Here! This Little Brother-In-Law Who Lives In the Country Went To Visit His Big Sister Who Wo

  • censoredHUNTAhunterkawajirihhh groupHUNTA-512HUNTA512hunta00512
    • 2018-11-03
    148 min

    [PRED-110]The Total Domain Of An Elder Sister In Knee-High Socks Who Is Giving Me The Golden Shower Slut Treatment Yu Asakura

  • yu asakura censoredslutsingle workPREDpremiumk westelegancePRED-110PRED110pred00110
    • 2018-11-02
    174 min

    [DROP-031]Amateur Girls Their First Cock Washing Part-Time Job 2

  • censoredamateurblowjobDROPoffice k sdrop office k sDROP-031DROP03136drop00031
    • 2018-11-02
    120 min

    [DOKS-458]Mind-Numbing Titty Torture 2 My Dick's at the Point Where I'd Bust My Nut at a Touch that Never Comes, Suffering Wave After Wave of Torture, Driving me Crazy...

  • red orchid yua sakashita censoredblowjobslutDOKSoffice k sforever youngDOKS-458DOKS45836doks00458
    • 2018-10-31
    137 min

    [GVG-770]A Sexy Weather Girl And Naughty Brats. Akari Mitani

  • mitani akari censoredsingle workdramaGVGglory questhyonGVG-770GVG77013gvg00770
    • 2018-10-27
    240 min

    [SGSR-221]Thanks For Protecting Me! Graduation From Virginity, A Favorite Memory! 13 Women 4 Hours of Best-Ever First-Times With Sensitive Young Women and Big-Tits Women

  • censoredSGSRbig morkaleigyochuushinsengumiSGSR-221SGSR22157sgsr00221
    • 2018-10-26
    240 min

    [BAZX-156]Luxurious Office Ladies. Working Women Star In A Porno During Their Lunch Break. Memorial Complete Best. 20 Women, 4 Hours

  • censoredcreampieBAZXmedia stationtodobazookaBAZX-156BAZX15661bazx00156
    • 2018-10-26
    242 min

    [SUPA-388]AVに出る気がなかったのに出演しちゃった激カワ素人娘4時間BEST

  • censoredamateurSUPAn aSUPA-388SUPA388h-244supa00388
    • 2018-10-25
    137 min

    [FSET-791]Beautiful Working Elder Sister Turned Slut Fucks Me 2

  • yui imai kirishima sakura censoredbig titsslutFSETakinorikyoaknrFSET-791FSET7911fset00791
    • 2018-10-23
    117 min

    [KTRA-073]Mio-chan Loves Her Older Brother! SEX With Mio Hinazuru

  • hina crane mio censoredbig titsbeautiful girlKTRAk tribeKTRA-073KTRA073h-094ktra00073
    • 2018-10-22
    101 min

    [XVSR-425]3 Days And 2 Nights Of Creampies, Under One Roof With My Slutty Married Sister Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-425XVSR425xvsr00425
    • 2018-10-22
    125 min

    [SNTR-002]Younger Jerk Takes Her To A Hotel, Films The SEX On Hidden Camera, And Sells It As Porn. vol. 2

  • censoredamateurSNTRsojitsusha mousouzokuSNTR-002SNTR002sntr00002
    • 2018-10-22
    152 min

    [APKH-083]Taunting Threesome Shoot. I Went To Visit A Neighbor Who Lived Alone To Share A Gift... And He Molested Me... Manami Oura

  • manami oura censoredcreampiesingle workAPKHaurora project annexaurora project anexAPKH-083APKH083apkh00083
    • 2018-10-21
    171 min

    [MISM-110]Fuck Her In The Mouth Till She Throws Up. The Craziest Deep Throating. Sayuki Mogami

  • sayuki mogami censoreddeepthroatsingle workMISMm girls labkokoa kuroMISM-110MISM110mism00110
    • 2018-10-21
    119 min

    [CJOD-166]Relentless Male Squirting/Relentless Forced Creampies! "I'm Already Ejaculating!" 365 Days, The Insatiable Girl Won't Stop Fucking Me Satomi Suzuki

  • satomi suzuki censoredcreampiesquirtingCJODchijo heavenkogoro kindaichiCJOD-166CJOD166cjod00166
    • 2018-10-21
    120 min

    [DASD-470]Cock Slip. Seri Hoshi

  • star seri censoredsingle workdramaDASDdashiromichi hoseDASD-470DASD470dasd00470
    • 2018-10-21
    150 min

    [CJOD-163]Squeaky Clean Ass Play with the Lady at the Bath Yu Shinoda

  • shinoda yu censoredcreampieslutCJODchijo heaveneightCJOD-163CJOD163cjod00163
    • 2018-10-19
    249 min

    [DOCP-099]Her Voluptuous Ass Is Tightly Stuck To My Cock!! Every Time She Teasingly Shakes Her Ass, She Can Feel My Cock Get Bigger, And Then She Began To Lure Me To Temptation With Some Sexy Rump Shaking...

  • misaka ria nanami yua censoredslutDOCPprestigedoc premiumDOCP-099DOCP099118docp00099
    • 2018-10-19
    133 min

    [TDSU-140]Creaming Herself With Pussy Juice! An Amateur Girl Finger Fucks Her Own Hole 4

  • censoredamateurTDSUoffice k ssonohitoTDSU-140TDSU14036tdsu00140
    • 2018-10-19
    136 min

    [KAGP-068]I Had Never Thought Of This Older Lady As A Woman Before, But When I Gave Her My Clothes To Wear, I Got Some Panty Shot And Nip Slip Action And I Could No Longer Resist, And Gave Her A Healthy Dose Of Rich And Thick Younger Man Semen In 99

  • anne mashiro yuuri censoredcreampiemomKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-068KAGP068kagp00068
    • 2018-10-18
    219 min

    [AP-595]Private Tutor Nipple Twisting Creampie Molester

  • censoredcreampieAPapachekuniokahhh groupAP-595AP595ap00595
    • 2018-10-18
    120 min

    [PPPD-705]My Girlfriend's Older Sister Is A Big Tits Babe Who Gave Me The Okay For Creampie Sign And Tried To Lure Me To Temptation Sarina Kurokawa

  • sarina kurokawa censoredcreampiebig titsPPPDoppaiPPPD-705PPPD705pppd00705



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online