censored jav high vision javcensored best omnibus




FC2IPXAUKGSQTENACXBLKFSDSSVEMAMVSDMILKPREDAWDSPRDROYDCESDADNHDKAAPODHODVSANAUKS

2020-09-25
51 min

FC2PPV 1511000 [No] First shot of Rina-chan, a fluffy little animal girl who is weak against pushing! Even though I haven’t taken the pill, if I’m asked during the etch, I’ll be OK with raw squirrel and vaginal cum shot and I’ll g

  • amateur uncensoredfc2
    • 2020-09-26
    60 min

    H0930 ori1583 Yuho Wazaki 35years old

  • amateur uncensoredh0930
    • 2020-09-30
    120 min

    [GVH-131]Sex With My Stepmom Hitomi Katase

  • hitomi katase censoredcreampiemomGVHglory questkabin kizakuraGVH-131GVH13113gvh00131
    • 2020-10-02
    56 min

    FC2PPV 1517312 [Personal shooting] Akemi-san, a beautiful busty Shinmama who has finished her work! In-car SEX in the parking lot in the afternoon !! Launch the accumulated semen! !!

  • amateur uncensoredfc2
    • 2020-10-04
    55 min

    210AKO-405 SHURI

  • amateur censoredcreampieamateurakoako-405ako405210ako-405
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-11-19
    150 min

    [MMKZ-087]Amazing Ass!! Waka Misono

  • misono waka censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-087MMKZ087mmkz00087
    • 2020-12-01
    23 min

    FC2PPV 1591011 [Individual] A naive young wife who is married due to a company bankruptcy is humiliated with a stick of another person and continues to pierce the sensitive vagina and vaginal cum shot with a sad expression.

  • amateur uncensoredfc2
    • 2020-12-02
    135 min

    [GVH-161]The Fully Nude Hot Spring Resort Inn From The Moment You Arrive Until Your Departure, This Big Tits, Big Ass, Shaved Pussy Madam And Servant Will Serve You With Naked Hospitality

  • arisa hanyu arisu hanyu airi takasaka censoredbig titsGVHglory questpoison pillGVH-161GVH16113gvh00161
    • 2020-12-02
    61 min

    [KBTV-048]The Girl Who Introduced Me To The Period Tracking App "Luna" Seems Like Such A Nice Girl, And Hey, If It's Not Her Period, That Means She's Down To Fuck, Right？

  • censoredbig titsamateurKBTVmessy tvKBTV-048KBTV048h-1514kbtv00048
    • 2020-12-09
    18 min

    FC2PPV 1600298 [No] Cum shot to H cup huge breasts married woman from sudden contact

  • amateur uncensoredfc2
    • 2020-12-10
    63 min

    413INST-077 Tomomi-chan, 21 years old ☆ Chi ● A devil’s rotor three-point blame on a milk dollar BODY that makes you squeeze ♪ Bikubiku cum man juice betting! G-spot Goryu Egg and serious soup dripping seeding complete agreement Peace sign ♪ Mou

  • amateur censoredcreampiebig titsinstinst-077inst077413inst-077
    • 2020-12-24
    93 min

    [OKS-102]It Clings Tightly To Her Body When It's Wet - Ibu Otohana - Enjoy The Sight Of A Cute Girl In Her School Swimsuit! - Peep On Her Getting Changed, See Her Big Tits, Shaved Pussy And Armpits, And Experience Lotion Play And Clothed Bukkake

  • otohana eve censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-102OKS1021oks00102
    • 2020-12-25
    45 min

    [fc2-ppv 1615712]【無×歯磨き】濡れたマン毛が妙にエロい…寿司食べて露天風呂でセックス【前編】

  • amateur uncensoredfc2
    • 2020-12-25
    120 min

    [NEM-050]The New Abnormal Sex - MILF In Her Fifties Part 22 - Stepmom Watches Her Stepson Jerk Off To Get To Know Him Better Seiko Nagata

  • shigeko nagata censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-050NEM050143nem00050
    • 2021-01-08
    148 min

    [HODV-21539]The Unequaled Libido Release OfA Nurse That Won't Let Go Of Me - Inori Fukasawa

  • fukasawa inori censoredcreampiebig titsHODVh m pHODV-21539HODV215395642hodv21539
    • 2021-01-17
    121 min

    [KSBJ-114]A Son's Wife's Daydream NTR - Tsubasa Yano

  • yano tsubasa censoredcreampiemarried womanKSBJksb planning emanuelcherryKSBJ-114KSBJ114ksbj00114
    • 2021-01-23
    153 min

    [HND-937]A Fresh Face Babe Who Provides Great Service And Is A Genius At Sex!! This Hard-Working Beautiful Girl Has Experience In Over 50 Different Types Of Customer Service Jobs, And Now, She's Finally Arrived At Her Ultimate Destination... A Re

  • censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-937HND937hnd00937
    • 2021-01-29
    46 min

    [fan-102]あさか

  • amateur censoredbig titsamateurfanfan-102fan102fan-102
    • 2021-01-31
    160 min

    [LULU-056]Female Anchor Can't Say No To Her Boss - He Trains Her Hard Nipples Day After Day Until They're So Sensitive His Touches Make Her Cum Maika Hiizumi

  • maika hizumi censoredcreampiesingle workLULUlunaticsvagmanLULU-056LULU056lulu00056
    • 2021-02-12
    31 min

    [CLO-123]Cleavage Shots ... Her Bulging Big Tits Look So Naughty Underneath Her Clothes Haruka Koide

  • haruka koide censoredbig titsblowjobCLOchobitchchovicCLO-123CLO123h-1435clo00123
    • 2021-03-05
    41 min

    FC2PPV 1713074 [Personal shooting] A slender married woman who accepts other people’s cocks because her husband is unemployed and supports her household budget! [Creampie]

  • amateur uncensoredfc2
    • 2021-03-10
    52 min

    FC2PPV 1719387 [Personal shooting] ♀ 302LJ series Yu ◯ -chan 18 years old 1st time first shot! A natural G-cup Lori busty girl who is mistaken for J © gets pregnant at the same time as graduating with a dangerous day cum shot! ？？ (LOL)

  • amateur uncensoredfc2
    • 2021-03-25
    109 min

    [SPRD-1391]He's Much Better Than My Husband... Shoko Tokuyama

  • shoko tokuyama censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1391SPRD139118sprd01391
    • 2021-04-08
    115 min

    [JRZE-040]First Time Filming My Affair - Ryoka Aoyama

  • ryoka aoyama censoredcreampiemarried womanJRZEcenter villagesouthern earthjurakuJRZE-040JRZE040h-086jrze00040
    • 2021-04-23
    57 min

    FC2PPV 1782414 Yuika 20 years old Absolutely beautiful girl! Pure white mochi fluffy mozzarella body job hunting student! It’s super sensitive and cums while wearing a suit! A transcendent beautiful girl’s fluffy shaved pussy is seeded and

  • amateur uncensoredfc2
    • 2021-04-29
    50 min

    C0930 ki210429 Madoka Sekiguchi 38years old

  • amateur uncensoredc0930
    • 2021-05-05
    133 min

    [GVH-226]Titty Loving Shota-kun's Lewd Prank Nenne Ui

  • first love censoredbig titssingle workGVHglory questtorindoru tanakaGVH-226GVH22613gvh00226
    • 2021-05-06
    73 min

    [REBD-552]Tsubaki 2 Southern Shangri La / Tsubaki Sannomiya

  • sannomiya tsubaki censoredsingle workREBDrebeccaherpes takaREBD-552REBD552h-346rebd00552
    • 2021-05-14
    149 min

    [DVDMS-669]Having A Quickie With The Fair-Skinned Big-Assed Cleaning Woman! She Loved My Big Dick So Much She Came Back The Next Day For More 4

  • censoredcreampiebig titsDVDMSdeep sswing nagaseDVDMS-669DVDMS669dvdms00669
    • 2021-05-15
    129 min

    [ONSG-035]Big Titty Escort Hana Himesaki

  • himesaki hana censoredcreampiebig titsONSGgain corporationONSG-035ONSG035onsg00035
    • 2021-05-22
    238 min

    [GENS-020]

  • kataoka nagisa censoredmature womansingle workGENSgenekigoldfish dGENS-020GENS020gens00020
    • 2021-05-29
    126 min

    390JAC-096 [Continuous Saddle Tide x 20-year-old Professional Student x Raw Saddle 4 Barrage] Pitch Pichi’s 20-year-old enters the freestyle SEX medley! Continuous splash with Saddle tide quick turn! !! Climax butterfly with strangling SEX! !! G

  • amateur censoredcreampiesquirtingjacjac-096jac096390jac-096
    • 2021-06-11
    36 min

    359TYVM-164 Seeding Fuck With A Big Tits Wife Who Indecently Enjoys A Cheating Stick That Blooms With Caress Caress! !!

  • amateur censoredcreampiebig titstyvmtyvm-164tyvm164359tyvm-164
    • 2021-07-02
    36 min

    520SSK-011 Rin

  • amateur censoredcreampieamateursskssk-011ssk011520ssk-011
    • 2021-07-07
    125 min

    300MIUM-728 [G Milk Semen Mania] Kuchima who loves kissing ● Aim at the lips of this office lady for 24 hours! Guju Guju Spermakis development is a problematic work of reading attention.

  • amateur censoredbig titssquirtingmiummium-728mium728300mium-728
    • 2021-07-10
    217 min

    [BAZX-298]Thick Sex With A Widow In Mourning Dress vol. 004

  • censoredcreampieBAZXbazookatodoBAZX-298BAZX298bazx00298
    • 2021-07-17
    180 min

    [CAWD-254]A Healthy And Beautiful Body This Female College S*****t Is A Super Popular 20-Year Old Influencer With Short Hair, Who Operates A Live Video Streaming Site, And Now She's Getting Naked For Us! Asuka Hanahara

  • hanahara asuka censoreduniformsingle workCAWDkawaiikannana dainanaCAWD-254CAWD254cawd00254
    • 2021-07-31
    61 min

    Caribbeancom 073121-001 The Girl Who Is Always Releasing Pheromones Anri Tachibana

  • anri tachibana uncensoredcreampiehandjobcaribbeancom
    • 2021-08-05
    243 min

    [CVDX-458]She Twisted Her Fingers Into Her Lingerie, Until She Had Stripped To Fully Naked Glory ... A Horny Housewife Undresses - A Deep And Rich Love Affair, While Secretly Peeping At Her Alluring Body - 30 Ladies 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-458CVDX458h-086cvdx00458
    • 2021-08-06
    61 min

    1Pondo 080621_001 Hustle Time With A Sexy Girl : Honoka Orihara

  • amateur uncensored1pondo
    • 2021-08-07
    169 min

    [TPIN-008]This Stepmother Came To Tokyo To Visit Her Stepson, Who Lives On His Own Yumina Hirosaki

  • yumina hirosaki censoredcreampiemomTPINtsubakihoinTPIN-008TPIN008tpin00008
    • 2021-08-12
    93 min

    [OKK-029]Meru Ito Glowing Wet And Clinging Tightly Godlike Competitive Swimsuit Get A Good Look At This Cute Loli Girl In Her Competitive Swimsuit! Starting With Peeping At Her Changing, Fetish Close Up Shots From Small To Big Tits, Shaved Pussy And

  • ito meru censoredbeautiful girlsingle workOKKoyaji no kosatsukamikyoueiOKK-029OKK0291okk00029
    • 2021-08-14
    60 min

    SIRO-4563 [First Shot] [Style ○ × Skin Quality ○ × Reaction ○] [Slutty Serious Girl’S Foolery] A 19-Year-Old Moody Beautiful Girl Who Aims To Become A Veterinarian Appears. Her Sensitive Young Skin Makes Her Cute Roar To Her Hard Roots And Erect

  • amateur censoredamateursirosiro-4563siro4563siro-4563
    • 2021-08-21
    42 min

    362SCOH-055 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [D] Rear 2] Rika Aimi

  • amateur censoredcreampieamateurscohscoh-055scoh055362scoh-055
    • 2021-08-27
    100 min

    [FTHT-025](Showing My Lewd "Ahegao" Face To My Friend! Pussy Right In View! Close-up Eye Contact Fucking!) "Getting It SO Deep!" Squirting Hard All Over The Bed. The Scent Of Dick All Around. Need More! Dripping Drool From Deep Throat

  • censoredcreampiesquirtingFTHTfalenodavielfaleno tubeFTHT-025FTHT0251ftht00025



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online