cowgirl jav def javcensored censored




FC2MIAADASDFSDSSHNDAWDMVSDSPRDDTTIPXSTARSAPODHMNAVSAKSBJDASDGMEMSSISONEZAUKSAUKG

2019-01-10
127 min

[IENE-960]My Sch**lgirl Little Sister Felt Sorry For My Loser Ass, So She Made Me Promise To Only Pussy Grind Me, Saying, "You Only Get To Rub Your Cock Against My Pussy, Okay？" But Then We Both Felt So Good That Her Pussy Got Dripping Wet! A

  • ayu saito alice mizushima censoredcreampiesisterIENEi energyie nergyIENE-960IENE9601iene00960
    • 2018-12-28
    242 min

    [WSP-154]We're Renting Out Fine Women 3 4 Hours

  • rino kirishima umi hirose censoredslutWSPwarp entertainmentsWSP-154WSP1542wsp00154
    • 2018-12-21
    60 min

    [PARATHD-2456]I Met This Girl In Fukuoka Who Spoke In This Really Cute Hakata Accent, And I Wanted To Fuck Her Really Bad (2)

  • censoredPARATHDparadise tvPARATHD-2456PARATHD2456parathd02456
    • 2018-12-14
    115 min

    [PARATHD-2471]Business Is Great! A Live Broadcast From A Pussy Hair Club This Is Where You Go To Have A Drink And Some Bush

  • saki mizumi ai rui censoredPARATHDparadise tvPARATHD-2471PARATHD2471parathd02471
    • 2018-12-14
    115 min

    [PARATHD-2460]We Met This Ultra Cute And Popular Sex Club Girl In Kabukicho, So Let's All Spend The Night At Her Place

  • censoredPARATHDparadise tvPARATHD-2460PARATHD2460parathd02460
    • 2018-12-01
    115 min

    [PARATHD-2457]We Had A Social Mixer With These Horny-Looking Fifty-Something Mature Woman Babes, And They Proceeded To Suck And Slurp Every Last Drop Of Semen Out Of Us!

  • censoredmature womanPARATHDparadise tvPARATHD-2457PARATHD2457parathd02457
    • 2018-11-23
    115 min

    [PARATHD-2435]An Insatiable Grandpa Can't Control Himself Around His Grandson's Wife Who Has Big, Pointy Tits

  • censoredbig titsPARATHDparadise tvPARATHD-2435PARATHD2435parathd02435
    • 2018-11-22
    163 min

    [IENE-947]I Played Some Pranks On My Schoolgirl Little Sister While She Slept, But Then She Demanded Raw Creampie Sex, And When I Was About To Cum, She Locked Her Legs Around Me And Wouldn't Let Me Escape, So I Creampie Ejaculated My Load Into He

  • rui hizuki nanako miyamura censoredcreampieschoolgirlIENEi energychrysanthemumie nergyIENE-947IENE9471iene00947
    • 2018-11-16
    115 min

    [PARATHD-2448]I Actually Tried Getting Many Beautiful Trucker Girls Off With Sexual Massages (3)

  • censoredPARATHDparadise tvPARATHD-2448PARATHD2448parathd02448
    • 2018-11-10
    166 min

    [RHE-609]Peeping On Married Night Shift Nurses 9

  • censoredcreampiebig titsRHEhot entertainmentyen ikkimarried woman hot entertainmentRHE-609RHE60959rhe00609
    • 2018-11-09
    115 min

    [PARATHD-2439]My Divorcee Cousin Came Home to Pay Her Respects, But All I Wanted Was to Worship That Ass! Rolling Up Her Mourning Clothes and Creaming From Behind: Deluxe Edition

  • censoredPARATHDparadise tvPARATHD-2439PARATHD2439parathd02439
    • 2018-11-01
    120 min

    [UD-832]Beautiful Tits Cowgirl 32 Ladies

  • aika aimi yoshikawa censoredbig titsUDleotakayama ikoruUD-832UD832
    • 2018-10-26
    60 min

    [WKD-010]Provactive Interview Room Shino Aoi

  • megumi shino censoredblowjobWKDwarp entertainmentk westwWKD-010WKD0102wkd00010
    • 2018-10-21
    151 min

    [HND-584]Flirtatious Provocative Dance. Fucking At Full Power And Making Men Come Until The Music Stops. Creampies. Akari Mitani

  • mitani akari censoredbeautiful girlHNDbooknanzaki masakiHND-584HND584hnd00584
    • 2018-10-18
    181 min

    [HUNTA-505]Girls Who Live Under Super Strict Rules At A Dormitory Are Super Horny And Begging For Some Quickie Cock Action! If You Step Into A Dorm With A Male Prohibition Policy, You're Finished Because The Girls Are Excessively Horny And They W

  • censoredschoolgirlHUNTAhunterkonjac kanohhh groupHUNTA-505HUNTA505hunta00505
    • 2018-10-12
    115 min

    [PARATHD-2409]Coming Back From A Wedding Ceremony, Two Exhibitionist 30-Something Women Fuck Pretty Much Every Guy That Was At The Wedding! (3)

  • censoredmature womanPARATHDparadise tvPARATHD-2409PARATHD2409parathd02409
    • 2018-10-12
    115 min

    [PARATHD-2415]Will The Female Masseuses In Business Hotels Across The Country Let Us Fuck Them？ Special (6) ~Osaka, Sapporo, Fukushima Edition

  • censoredPARATHDparadise tvPARATHD-2415PARATHD2415parathd02415
    • 2018-09-28
    115 min

    [PARATHD-2402]A Sex Partner Introduction Service For Middle-Aged People "The Poppy Association" Is Secretly A Quickie Fuck Club!

  • censoredmature womanPARATHDparadise tvPARATHD-2402PARATHD2402parathd02402
    • 2018-09-22
    154 min

    [JUY-627]My Horny Auntie Is Shaking Her Ass In Sweaty, Hot And Overwhelming Lust, And I Could Never Even Get A Thrust In Before She Made Me Cum Hitomi Enjoji

  • hitomi enjo censoredbig titsmarried womanJUYmadonnamasao koyamaJUY-627JUY627juy00627
    • 2018-09-22
    118 min

    [HND-577]I Gathered All My Friends And Force Fucked And Impregnated A Neighbor Gal In Cowgirl Gang Bang. AIKA

  • aika censoredcreampiebig titsHNDbooktiger gavelHND-577HND577hnd00577
    • 2018-09-22
    146 min

    [CJOD-159]Creampie In Her Ass And Pussy Lusty Slutty Maid Rui Hizuki

  • rui hizuki censoredcreampieslutCJODslut haventequilatinoCJOD-159CJOD159cjod00159
    • 2018-09-22
    120 min

    [HND-576]Slut Gets Creampied With Amazing Nipple Play And Milks It Out With Her Pussy Yu Shinoda

  • shinoda yu censoredbig titsbeautiful girlHNDbookrusher miyoshiHND-576HND576hnd00576
    • 2018-09-21
    115 min

    [PARATHD-2383]We Put Up Posters Advertising The Services Of A Muscular Handyman In An Affluent Neighborhood And Effortlessly Scored Horny, Wealthy Madams

  • censoredmarried womanblowjobPARATHDparadise tvPARATHD-2383PARATHD2383parathd02383
    • 2018-09-20
    162 min

    [MIST-228]Favorite Girl From Famous Titty Bar In Japan's Biggest Downtown Area Fucks Raw In Cowgirl Until Creampie H Cup Aimi Yoshikawa

  • yoshikawa aimi censoredcreampiebig titsMISTmr michirusaitaMIST-228MIST2281mist00228
    • 2018-09-15
    190 min

    [WA-388]Anal Baring An Amateur Wife Gets Hot And Horny With A Kiss And Gives A Cherry Boy His Cherry Popping! She'll Give Him His First 12 Cum Shots of Spider Cowgirl Loving!

  • censoredmarried womanmature womanWAlotuskikufukuWA-388WA388h-047wa00388
    • 2018-09-14
    146 min

    [VRTM-380]A Cherry Boy Son Who Lusts For His Loving Big Titty Mother-In-Law Begs For A Titty Fuck! When His Dick Is Wedged In Between Her Soft Titties, He Gets An Unstoppable Erection, And Goes For Some Raw Cock Pussy Insertion! He Prematurely Ejacul

  • ren fukusaki kimishima mio censoredcreampiebig titsVRTMv r produceyamanaka socksVRTM-380VRTM380h-910vrtm00380
    • 2018-09-14
    140 min

    [TEM-080]If You See Somebody In Trouble, Help Them! The Hot MILF Next Door Who Was Way Too Helpful 4

  • chie aoi jun hazuki censoredbig titsmarried womanTEMprestigetemptationTEM-080TEM080118tem00080
    • 2018-09-14
    186 min

    [SCPX-297]I Had No Idea That My Pretty Aunt Would Be Shaving Her Pussy Hair Like That... Seeing Her Taking Care Of Her Pussy Made My Dick Rock Hard And Maybe She Took Pity On Me, Because She Decided To Take Her Unguarded Pussy And Slip My Dick Inside

  • censoredcreampiebig titsSCPXscoopnabeSCPX-297SCPX297h-565scpx00297
    • 2018-09-09
    125 min

    [DVAJ-349]My Sister Lets Me Put The First 3 cm In, Just Barely Not Incest Nanami Kawakami

  • kawakami nanami censoredcreampiesisterDVAJalice japanviva gonzoDVAJ-349DVAJ349dvaj00349
    • 2018-09-09
    130 min

    [DVAJ-350]Pussy Pounding Piston Cowgirl Action Produces Bubbling Pussy Juice Foam Around Your Cock And Then She'll Treat You To A Blowjob And Reward You With Another Dose Of Pussy In A P-To-M Sex Session Akari Mitani

  • mitani akari censoredcreampieblowjobDVAJalice japancomet akaiDVAJ-350DVAJ350dvaj00350
    • 2018-09-08
    119 min

    [IPX-200]Loves Blowjob So Much... Has To Suck Before Shower! Then A Fuck! Multiple Cumshot Promise Amazing Technique Soapland Girl Nono Yuiki

  • yuki s censoredblowjobbeautiful girlIPXidea pockettake dtissueIPX-200IPX200ipx00200
    • 2018-09-08
    159 min

    [MIAE-307]Female Teacher With A Tight Skirt's Thick Thigh Temptation Total Domain Yui Hatano

  • yui hatano censoredMIAEmoody shironori miyasemoodyz acidMIAE-307MIAE307miae00307
    • 2018-09-08
    149 min

    [EBOD-653]An 8-Year Competitive Career! She Was Good Enough To Be Awarded The Fighting-Spirit Award At The National Tournament! This Big Tits Athlete With Long Arms And Legs Is A Real-Life Beach Volleyball Player Her AV Debut! Yuna Sobi

  • yuna aimi censoredbig titsEBODe bodyEBOD-653EBOD653ebod00653
    • 2018-09-08
    149 min

    [MEYD-418]Cum In Me Today Until I'm Pregnant... Yu Shinoda

  • shinoda yu censoredcreampieslutMEYDtameike goroomura universityMEYD-418MEYD418meyd00418
    • 2018-09-07
    204 min

    [DOCP-081]A Married Woman Who Is Raped Orgasms Repeatedly And Loses Her Mind. Her Pussy Won't Stop Convulsing As She Pushes Herself Against The Rapist And Gets Creampied

  • iori ohashi ashamed censoredcreampiemarried womanDOCPprestigedoc premiumDOCP-081DOCP081118docp00081
    • 2018-09-06
    139 min

    [STAR-967]Masami Ichikawa. From Fast To Slow, Teasing, Gear-Changing Blowjob

  • masami ichikawa censoredblowjobSTARsod createnanzaki masakisod starSTAR-967STAR9671star00967
    • 2018-09-06
    215 min

    [DANDY-622]'"Are You Sure You Don't Mind Being With An Older Woman？" Held Against The Young, 150 Degree Erect Cock Of A Young Stud, These Nurses Don't Actually Mind Getting Fucked.' vol. 8

  • censoreduniformcosplayDANDYdandyokayama parsleyDANDY-622DANDY6221dandy00622
    • 2018-09-02
    240 min

    [DVDMS-300]The Magic Mirror Number Bus Faces Revealed! College Girl Babes Only A Thorough Investigation! These Real-Life Amateur College Student Friends Are Engaging In Their First Ever Mutual Masturbation Session In A Locked Room 5 They've Never

  • censoredamateurDVDMSdeepskomaba shelleythe magic mirror mm mm flightsDVDMS-300DVDMS300dvdms00300
    • 2018-09-01
    121 min

    [HDKA-147]The Naked Maid The Nude Maid Placement Center Maria Aizawa

  • maria serizawa censoredbig titsblowjobHDKAplanet plusbirdman teppeinudityHDKA-147HDKA147h-237hdka00147
    • 2018-08-31
    242 min

    [HFD-172]Temptation Massage Salon Best

  • miho tsuno mari rika censoredslutHFDdream ticketHFD-172HFD17224hfd00172
    • 2018-08-31
    47 min

    [WKD-008]Kaho Shibuya Is Showing Off Her Massive Big Titty Fuck Technique For Pleasing Men

  • kaho shibuya censoredsquirtingslutWKDwarp entertainmentk westwWKD-008WKD0082wkd00008
    • 2018-08-28
    124 min

    [GODR-887]Huge Ass Anal Full View Cowgirl 12 Girls

  • censoredGODRviphassygodGODR-887GODR88778godr00887
    • 2018-08-25
    177 min

    [MIAE-298]Cowgirl Soapland Makes You Cum Over And Over With Perfect Thrusting Nozomi Hara

  • suhara nozomi censoredbig titsslutMIAEmoody sdragon nishikawamoodyz acidMIAE-298MIAE298miae00298
    • 2018-08-25
    132 min

    [JUFD-949]From Edging Slow Fuck To Intense Cowgirl Huge Ass Female Boss Kanako Kase

  • kanase kase censoredcreampieslutJUFDfitchJUFD-949JUFD949jufd00949
    • 2018-08-24
    201 min

    [SCPX-292]We Were All Sleeping Together On The Floor, But Then The Couple Next To Us Started Fucking! I Quietly Peeped At Them, And Then She Looked Straight At Me While She Was Shaking Her Ass! At First She Blushed In Embarrassment, But Then As Her B

  • censoredcreampieSCPXscoopkhao leSCPX-292SCPX292h-565scpx00292
    • 2018-08-24
    266 min

    [SCPX-293]Lately, My Little Sister Has Awakened To The Pleasures Of Sex, And Now She's Paying Me A Night Visit To Play With My Rock Hard Morning Wood! My Big Brother's Big Cock Feels So Good! She Enjoyed Rubbing It So Much That She Decided To

  • censoredcreampiebig titsSCPXscoopSCPX-293SCPX293h-565scpx00293



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online