cowgirl




FC2VENUHMNEBODGMEMRBDNGODHNDCAWDJUFEHUNTBSPRDVEMAFSDSSPREDAVSASQTEADNWANZIPXWAAA

2018-09-28
71 min

[WKD-009]Record Of A Married Women's Adulterous Tryst. Kanako Maeda

  • kanako maeda censoredblowjobsingle workWKDwaap entertainmentk westwWKD-009WKD0092wkd00009
    • 2018-09-26
    52 min

    FC2PPV 939667 [Reversal Creampie] S-class neat and clean busty girl sweaty rich sailor suit “Retribution ♥” waist cramps convulsions continuous cum revenge skewered size stop cowgirl [no moza] bonus video available

  • amateur uncensoredfc2
    • 2018-09-22
    154 min

    [JUY-627]My Horny Auntie Is Shaking Her Ass In Sweaty, Hot And Overwhelming Lust, And I Could Never Even Get A Thrust In Before She Made Me Cum Hitomi Enjoji

  • hitomi enjo censoredbig titsmarried womanJUYmadonnamasao koyamaJUY-627JUY627juy00627
    • 2018-09-22
    118 min

    [HND-577]I Gathered All My Friends And Force Fucked And Impregnated A Neighbor Gal In Cowgirl Gang Bang. AIKA

  • aika censoredcreampiebig titsHNDbooktiger gavelHND-577HND577hnd00577
    • 2018-09-22
    146 min

    [CJOD-159]Creampie In Her Ass And Pussy Lusty Slutty Maid Rui Hizuki

  • rui hizuki censoredcreampieslutCJODslut haventequilatinoCJOD-159CJOD159cjod00159
    • 2018-09-22
    120 min

    [HND-576]Slut Gets Creampied With Amazing Nipple Play And Milks It Out With Her Pussy Yu Shinoda

  • shinoda yu censoredbig titsbeautiful girlHNDbookrusher miyoshiHND-576HND576hnd00576
    • 2018-09-21
    115 min

    [PARATHD-2383]We Put Up Posters Advertising The Services Of A Muscular Handyman In An Affluent Neighborhood And Effortlessly Scored Horny, Wealthy Madams

  • censoredmarried womanblowjobPARATHDparadise tvPARATHD-2383PARATHD2383parathd02383
    • 2018-09-20
    139 min

    [SDDE-552][Uniform/Underwear/Fully Nude] Full Service Hospitality Crouching Pussy Airlines 9 A Creampie Flight

  • censoredcreampieuniformSDDEsod createsakai shiberiaSDDE-552SDDE5521sdde00552
    • 2018-09-20
    162 min

    [MIST-228]Favorite Girl From Famous Titty Bar In Japan's Biggest Downtown Area Fucks Raw In Cowgirl Until Creampie H Cup Aimi Yoshikawa

  • yoshikawa aimi censoredcreampiebig titsMISTmr michirusaitaMIST-228MIST2281mist00228
    • 2018-09-16
    297 min

    [HUNTA-494]I'm At A Shared Living House Surrounded By Thirty-Something Divorcee Ladies, And I'm The Only Man! 2 I Want A Girlfriend! I Was Looking For Love And Moved Into This Shared Living House, But It Was Filled With Divorcee Ladies...

  • censoredHUNTAhunterkawajirihhh groupHUNTA-494HUNTA494hunta00494
    • 2018-09-16
    241 min

    [HUNTA-497]"No! If You Move Like That It'll Accidentally Go In!! Please... Don't Go Further Than Humping..." Sexy Play With My Big Breasted Step Mom Gets Messy and Out of Hand!!

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-497HUNTA497hunta00497
    • 2018-09-16
    197 min

    [GDHH-120]Time to Recollect Debt from my Sister in Law! She Owes Me a Ton and I Decide it is Time to Pay Up... with Her Body! She Had no Intention of Paying Me Back but Now I Get My Way with Her Lips, Tits, and More!

  • censoredschoolgirlsisterGDHHprime timekorosukehhh groupGDHH-120GDHH120gdhh00120
    • 2018-09-16
    211 min

    [ATOM-344]Torako The Female Director Presents Girls Get Together For A Girls' Talk Clear-The-Air Horny Sex Experience How About Pussy Grinding While Wearing A Thong？ When That Rock Hard Cock Rubs Against Her Pussy, It Feels So Good...

  • censoredamateurATOMatomhhh groupATOM-344ATOM344atom00344
    • 2018-09-16
    160 min

    [DVDMS-308]A Normal Boys And Girls Focus Group AV See What Happens When These Friends Are Locked Together In A Room And Consult Each Other About Their Sexual Problems The Cutest College Girl At University And A Cherry Boy Who Keeps Getting Turned Dow

  • censoredamateurDVDMSdeepsmatsushima zaradeep sDVDMS-308DVDMS308dvdms00308
    • 2018-09-16
    240 min

    [HUNTA-493]"If You Don't Mind Just A Handjob, I'll Do It..." My Little Sister-In-Law Was Now My Lover Until Midnight! I Was In Love With This Girl And She Turned Me Down In The Most Unbelievable Way, So...

  • amateur censoredschoolgirlhandjobHUNTAhunterHUNTA-493HUNTA493
    • 2018-09-15
    153 min

    [BLK-378]Incredible Pussy Pounding Cowgirl Sex! A Big Ass Southern American Half-Japanese Gal Makes Her AV Debut!!

  • roberto miura anna censoredslutsingle workBLKkira kiraupdatingBLK-378BLK378blk00378
    • 2018-09-15
    190 min

    [WA-388]Anal Baring An Amateur Wife Gets Hot And Horny With A Kiss And Gives A Cherry Boy His Cherry Popping! She'll Give Him His First 12 Cum Shots of Spider Cowgirl Loving!

  • censoredmarried womanmature womanWAlotuskikufukuWA-388WA388h-047wa00388
    • 2018-09-15
    120 min

    [BLK-380]Special Sex Party for Wealthy Men Only! AIKA Feverishly Rides You in the Cowgirl Position Begging for You to Cum Inside Her!

  • aika censoredcreampiesingle workBLKkira kiraupdatingBLK-380BLK380blk00380
    • 2018-09-14
    194 min

    [SCPX-296]The Three Of Us Were Drinking At My House When My Best Friend's Girlfriend Started To French Kiss Me, And I Was Afraid Of Being Caught, But She Was Getting So Horny, We Couldn't Stop, And Her Pussy Got So Wet It Was Getting Syrupy A

  • censoredcreampieblowjobSCPXk m producenabemousouzokuSCPX-296SCPX296h-565scpx00296
    • 2018-09-14
    146 min

    [VRTM-380]A Cherry Boy Son Who Lusts For His Loving Big Titty Mother-In-Law Begs For A Titty Fuck! When His Dick Is Wedged In Between Her Soft Titties, He Gets An Unstoppable Erection, And Goes For Some Raw Cock Pussy Insertion! He Prematurely Ejacul

  • ren fukusaki kimishima mio censoredcreampiebig titsVRTMv r produceyamanaka socksVRTM-380VRTM380h-910vrtm00380
    • 2018-09-14
    242 min

    [UMSO-205]Innocent And Sweet 18 Year Old Beautiful Girl's Clumsy Cowgirl 50 Girls

  • rina hatsume ayu hinata censoredUMSOkm produceumanamiUMSO-205UMSO20584umso00205
    • 2018-09-14
    148 min

    [VRTM-378]This Big Titty Sales Lady Came To The Home Of A Husband And Wife, And Now She's Quietly Tempting The Husband To Turn You On! Unable To Resist Her Luscious Tits, He Decides To Have Infidelity Sex! She Wants To Seal The Deal So Badly That

  • kurata mao hamazaki mao censoredcreampiebig titsVRTMv r produceeizo mochizukiVRTM-378VRTM378h-910vrtm00378
    • 2018-09-14
    123 min

    [MKMP-239]10 Loads In A Row Creampie Reika Hashimoto

  • reika hashimoto censoredcreampiesingle workMKMPk m produceupdatingmillionMKMP-239MKMP23984mkmp00239
    • 2018-09-14
    140 min

    [TEM-080]If You See Somebody In Trouble, Help Them! The Hot MILF Next Door Who Was Way Too Helpful 4

  • chie aoi jun hazuki censoredbig titsmarried womanTEMprestigetemptationTEM-080TEM080118tem00080
    • 2018-09-14
    137 min

    [XRW-554]I Gave An Aphrodisiac To A Busty Call Girl And Made Her Orgasm Over And Over Again. Ms Arisa

  • censoredcreampiebig titsXRWreal worksdocsyreal real worksXRW-554XRW554172xrw00554
    • 2018-09-14
    186 min

    [SCPX-297]I Had No Idea That My Pretty Aunt Would Be Shaving Her Pussy Hair Like That... Seeing Her Taking Care Of Her Pussy Made My Dick Rock Hard And Maybe She Took Pity On Me, Because She Decided To Take Her Unguarded Pussy And Slip My Dick Inside

  • censoredcreampiebig titsSCPXscoopnabeSCPX-297SCPX297h-565scpx00297
    • 2018-09-09
    125 min

    [DVAJ-349]My Sister Lets Me Put The First 3 cm In, Just Barely Not Incest Nanami Kawakami

  • kawakami nanami censoredcreampiesisterDVAJalice japanviva gonzoDVAJ-349DVAJ349dvaj00349
    • 2018-09-09
    130 min

    [DVAJ-350]Pussy Pounding Piston Cowgirl Action Produces Bubbling Pussy Juice Foam Around Your Cock And Then She'll Treat You To A Blowjob And Reward You With Another Dose Of Pussy In A P-To-M Sex Session Akari Mitani

  • mitani akari censoredcreampieblowjobDVAJalice japancomet akaiDVAJ-350DVAJ350dvaj00350
    • 2018-09-08
    119 min

    [IPX-200]Loves Blowjob So Much... Has To Suck Before Shower! Then A Fuck! Multiple Cumshot Promise Amazing Technique Soapland Girl Nono Yuiki

  • yuki s censoredblowjobbeautiful girlIPXidea pockettake dtissueIPX-200IPX200ipx00200
    • 2018-09-08
    159 min

    [MIAE-307]Female Teacher With A Tight Skirt's Thick Thigh Temptation Total Domain Yui Hatano

  • yui hatano censoredMIAEmoody shironori miyasemoodyz acidMIAE-307MIAE307miae00307
    • 2018-09-08
    149 min

    [EBOD-653]An 8-Year Competitive Career! She Was Good Enough To Be Awarded The Fighting-Spirit Award At The National Tournament! This Big Tits Athlete With Long Arms And Legs Is A Real-Life Beach Volleyball Player Her AV Debut! Yuna Sobi

  • yuna aimi censoredbig titsEBODe bodyEBOD-653EBOD653ebod00653
    • 2018-09-08
    149 min

    [MEYD-418]Cum In Me Today Until I'm Pregnant... Yu Shinoda

  • shinoda yu censoredcreampieslutMEYDtameike goroomura universityMEYD-418MEYD418meyd00418
    • 2018-09-07
    204 min

    [DOCP-081]A Married Woman Who Is Raped Orgasms Repeatedly And Loses Her Mind. Her Pussy Won't Stop Convulsing As She Pushes Herself Against The Rapist And Gets Creampied

  • iori ohashi ashamed censoredcreampiemarried womanDOCPprestigedoc premiumDOCP-081DOCP081118docp00081
    • 2018-09-06
    139 min

    [STAR-967]Masami Ichikawa. From Fast To Slow, Teasing, Gear-Changing Blowjob

  • masami ichikawa censoredblowjobSTARsod createnanzaki masakisod starSTAR-967STAR9671star00967
    • 2018-09-06
    215 min

    [DANDY-622]'"Are You Sure You Don't Mind Being With An Older Woman？" Held Against The Young, 150 Degree Erect Cock Of A Young Stud, These Nurses Don't Actually Mind Getting Fucked.' vol. 8

  • censoreduniformcosplayDANDYdandyokayama parsleyDANDY-622DANDY6221dandy00622
    • 2018-09-02
    108 min

    [NYKD-091]60 Something First Time Shots Maki Tadokoro

  • maki tadokoro censoredbig titsmature womanNYKDrubyteruichi umiyamaprincessNYKD-091NYKD091nykd00091
    • 2018-09-02
    246 min

    [MLSM-011]Top Rank Mature Woman Best Maki Hojo 4 Hours Slut Queen!

  • hojo asahi censoredcreampiemature womanMLSMmellow moonMLSM-011MLSM011mlsm00011
    • 2018-09-02
    240 min

    [DVDMS-300]The Magic Mirror Number Bus Faces Revealed! College Girl Babes Only A Thorough Investigation! These Real-Life Amateur College Student Friends Are Engaging In Their First Ever Mutual Masturbation Session In A Locked Room 5 They've Never

  • censoredamateurDVDMSdeepskomaba shelleythe magic mirror mm mm flightsDVDMS-300DVDMS300dvdms00300
    • 2018-09-02
    238 min

    [AST-060]Incest Creampie Sex With A Fifty-Something MILF 4 Hours/12 Ladies Special Collection Chapter 7

  • censoredcreampiemature womanASTrubysusumu yanoguchitreasure rubyAST-060AST060ast00060
    • 2018-09-02
    200 min

    [GDHH-117]"Teacher! Please Let Me Fuck, Just Once! At This Rate, I'll Get Left Behind!" She's Got The Looks! She's Got The Body! She's Even Got A Great Personality! She's A Perfect Score In Every Department! This Excessi

  • censoredGDHHgolden timekorosukeGDHH-117GDHH117gdhh00117
    • 2018-09-02
    218 min

    [OYC-204]My Stepmom Treats Me Like A Toy!! My Dad Got Remarried And Now My New Stepmom Is A Young And Beautiful Lady Who Is Still At The Peak Of Womanhood!! But My Dad Completely Neglects Her, So She Turned Her Sexual Appetite On Me!! Every Day... Ev

  • censoredstepmomOYCdinner.companyhamonhhh groupOYC-204OYC204oyc00204
    • 2018-09-02
    172 min

    [OYC-203]At This Guest House, All The Girls Are Guaranteed To Get Fucked I Just Want To Fuck Somebody! I Want Some New Excitement! This Curious And Precocious Girl On A Solo Trip Came To This Guest House, But Little Did She Know That It Was Filled Wi

  • censoredOYCdinner.companytoguro sistershhh groupOYC-203OYC203oyc00203
    • 2018-09-02
    84 min

    [OYC-202]I Would Have Rather Died Than Seen That! A Video From A BBQ Featuring My Fiancee And Her Friends From Her Part-Time Job All Big Tits Ver.

  • censoredbig titsOYCdinner.companyspace nyanjirohhh groupOYC-202OYC202oyc00202
    • 2018-09-02
    181 min

    [GDHH-118]I Moved To This New Apartment, And For Some Reason, These Cute Girls Keep On Cumming!？ These Girls Said, We Were The Last Tenant's Girlfriends, And Suddenly Started Crying! "We Didn't Know He Moved Away!" I Had No Choice, So

  • censoredGDHHprime timecomehhh groupGDHH-118GDHH118gdhh00118
    • 2018-09-02
    120 min

    [JRW-003]A True Story About A Real-Life Fully Nude Hot Springs Inn 2 After Reading About It On The Internet And Obsessing Over It, I Went On An Extremely Erotic Hot Springs Vacation To This Horny Inn That Will Satisfy Every Lustful Desire A Man Could

  • beautiful kyono censoredmature womansingle workJRWrubykatou sukerokuJRW-003JRW003jrw00003
    • 2018-09-02
    100 min

    [ANB-151]I Became My Mom's Sex Toy Tempting Hot Mother-In-Law Always Wants Cock! Kiyoka Taira

  • hira kiyoka censoredmature womanslutANBrubyyanoguchi susumuANB-151ANB151anb00151



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online