creampie pov high vision nampa censored




FC2ROYDSTARSCHRVHZGDATIDLULUNATRMILKAWDSHKDFSDSSVEMAMARAMIAAKSBJRBDCJODVENUSQTEHDKA

2020-10-01
134 min

[JJPP-173]Peeping Video Shows Prettyboy Bringing Mature Woman Home For Fuck. Only On FANZA! Pre-Release Special! 106

  • censoredcreampiemature womanJJPPjukujo japanJJPP-173JJPP173jjpp00173
    • 2020-10-08
    160 min

    [MIST-315]Private Titty Bar - Her Business Is Losing Money Due To The Pandemic And She Needs Cash... She's Willing To Take A Creampie On The Sly Too Shiori Tsukada

  • shiori tsukada censoredcreampiesingle workMISTmr michirusaitaMIST-315MIST3151mist00315
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-24
    164 min

    [DASD-744]Semen Loving, Semen Addict Transsexual - Yura Tenshi

  • angel yura censoredblowjobbeautiful girlDASDdasnao masakiDASD-744DASD744dasd00744
    • 2020-11-06
    125 min

    [JUL-361]Runaway Wife! My Week Living Together With A Tipsy Married Woman Office Lady I Picked Up. Mizuho Aoyama

  • mizuho aoyama censoredbig titsmature womanJULmadonnadai omuraJUL-361JUL361jul00361
    • 2020-11-07
    240 min

    [MMMB-036]An Old Lady With Short Hair! She's Got A Neckline That You'll Want To Suck And Slurp! 4 Hours

  • censoredcreampiebig titsMMMBmellow moonpig momMMMB-036MMMB036mmmb00036
    • 2020-11-07
    140 min

    [PKPD-118]A Mini-Sized J* In Black Pantyhose Who's Ready For Her Creampie POV Closeup Hikaru & Kokomi

  • censoredcreampiebeautiful girlPKPDfuck group and fun friends daydreamersPKPD-118PKPD118pkpd00118
    • 2020-11-12
    159 min

    [SVDVD-825]Wanted Amateurs The Young Wife Machine Vibrator Challenge! If You Can Resist Squirting Until The End You'll Win 1 Million Yen! If You Can't, It's Creampie Sex Time! Col 2

  • censoredcreampieSVDVDsadistic villagesushi yokuboSVDVD-825SVDVD8251svdvd00825
    • 2020-11-13
    149 min

    [SCPX-411]They Call Me The Guy That Lives In The Room... A Mom And Younger Sister Do What I Tell Them

  • censoredcreampiebig titsSCPXscoophasshimousouzokuSCPX-411SCPX411h-565scpx00411
    • 2020-11-23
    62 min

    FC2PPV 1581043 [First-run limited 1980] Restructuring a certain hard profession Sister ❤️ Cut down your savings and remove the squirrel ❤️ No inside! Out! It is said that I go out live … Unauthorized vaginal cum shot from! ❤️ * There are review

  • amateur uncensoredfc2
    • 2020-11-28
    120 min

    [JJDA-012]A Housewife Who Works As Part-time Housekeeper Is Nice To A Fault - Arisa Hanyu

  • arisa hanyu arisu hanyu censoredcreampiebig titsJJDAmature woman college real mature womanhirokoji osakimanji groupJJDA-012JJDA012jjda00012
    • 2020-12-01
    158 min

    [C-2597]Secret Diary #013

  • censoredCgogoskoichi takahashigogo s coreC-2597C2597140c02597
    • 2020-12-10
    25 min

    [opcyn-128]ななみ(21)

  • amateur censoredcreampieamateuropcynopcyn-128opcyn128opcyn-128
    • 2020-12-12
    118 min

    [IPX-575]My Girlfriend's Got Big Tits And Incredible Sex Appeal - Adorable Babe With A Birthmark Rio Kuriyama

  • rio kuriyama honda satomi censoredbig titsbeautiful girlIPXidea pocketkyoseidishIPX-575IPX575ipx00575
    • 2020-12-26

    C0930/H0930/H4610 ki201228 Amateur Organs

  • amateur uncensoredc0930
    • 2020-12-31
    94 min

    [HTHD-182]My Friend's Mother - The Final Chapter - Aiko Kuribayashi

  • aiko kuribayashi censoredcreampiemature womanHTHDcenter villagekotaro misatohona zonoHTHD-182HTHD182h-086hthd00182
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-16
    191 min

    [HUNTA-926]My Sister-In-Law Is Always Waiting For My Big Brother To Come Home After Working Overtime, Late Into The Night, And Since She's Super Horny, I'm Always Fucking Her Brains Out For 8 Hours At A Time Until He Returns Home.

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-926HUNTA926hunta00926
    • 2021-01-21
    81 min

    [REBD-528]Kanon, Young Lady Under The Moon - Kanon Tsukishima

  • tsukishima kanon censoredsingle workREBDrebeccachikara sawamuraREBD-528REBD528h-346rebd00528
    • 2021-02-04
    95 min

    [hoi-158]まこ(29)

  • amateur censoredamateurbeautiful girlhoihoi-158hoi158hoi-158
    • 2021-02-05
    244 min

    [DOCP-273]"Is She An Angel!？ Or The Devil!？" This Beautiful Nurse Is Actually Super Horny! She's Sucking Up Semen With Her Tight Little Pussy And Giving Me A Cowgirl Ride And Squeezing Out All My Semen, Over And Over Again. 3

  • emily hikari sakuraba kanobuki censoredcreampieamateurDOCPprestigedoc premiumDOCP-273DOCP273118docp00273
    • 2021-02-22
    135 min

    [HOMA-102]The Night Before The Cultural Fair, I Experimented With Sex To My Heart's Content With 2 Otaku Babes From The Manga Research Club

  • mizuki yayoi inaba censoredcreampieschoolgirlHOMAh m p doramajo asagiriHOMA-102HOMA102homa00102
    • 2021-02-22
    148 min

    [CESD-978]Totally Freshly Filmed Footage Of Real And Deep And Rich Sex With Ayano Fuji In 4 Exclusive Fucks!

  • ayano kato censoredmature womanslutCESDceleb no tomoCESD-978CESD978cesd00978
    • 2021-03-01
    66 min

    324SRTD-0217 Picking Up A Dirty Married Woman Who Is Not Satisfied With Child Making SEX

  • amateur censoredcreampiemarried womansrtdsrtd-0217srtd0217324srtd-0217
    • 2021-03-03
    240 min

    [RVH-007]Girls Possessed By Exhibitionist/G*******g/Bukkake Desires Best Hits Collection vol. 1

  • yano tsubasa rin kosaka censoredslutbukkakeRVHglory questRVH-007RVH00713rvh00007
    • 2021-03-03
    150 min

    [PFES-019]My Sweet But Devilish C***dhood Friend Snuck Into My Room In Her Panties And Fucked Me Until She Felt Like A Woman! Hina Nanami

  • hina nanami hina nanase censoredcreampieblowjobPFESm s video groupsummer panties festivalPFES-019PFES019pfes00019
    • 2021-03-11
    41 min

    FC2PPV 1721029 * None * First shot! !! Big Breasts H Cup ☆ Celebrity Married Woman Marin (25) Living in Minato Ward Finally Debuts Raw Saddle In The Third Year Of Sexless ♡ Luxury Review Benefits Available

  • amateur uncensoredfc2
    • 2021-03-13
    118 min

    [VEO-039]She's Back And Squirting Breast Milk!! Giant Ballon Titties Hinami Narusawa Is In Her Forties And Back In Action

  • hinami narusawa censoredcreampiebig titsVEOvenusbingo tamatsukabornVEO-039VEO039veo00039
    • 2021-03-15
    76 min

    FC2PPV 1711124 [G cup slime milk] I will expose private SEX with a big tits big butt gal w Blow with an erotic tongue with an open tongue is the best! Geki Yabahame shooting video that pierces from the top to the bottom and shakes the huge breasts

  • amateur uncensoredfc2
    • 2021-03-15
    72 min

    FC2PPV 1721361 [Individual] Slender intellectual beautiful wife, intelligent tax accountant, 50 years old, accident-level screaming crying Gonzo with pleasure to break [First special price]

  • amateur uncensoredfc2
    • 2021-03-15
    48 min

    492MERC-249 Former Ekiden player. 2

  • amateur censoredcreampieamateurmercmerc-249merc249492merc-249
    • 2021-03-27
    118 min

    [JJBB-008]We Heard About This Mature Woman Pink Salon Where The Ladies Were Loose And Easy, So We Decided To See How Far We Could Go 08

  • censoredcreampiemature womanJJBBjukujo japanJJBB-008JJBB008jjbb00008
    • 2021-04-08
    93 min

    [OKB-109]A Voluptuous Big Ass A Goddess In Bloomers Shion Natsume From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy

  • shion natsume censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-109OKB1091okb00109
    • 2021-04-14
    64 min

    FC2PPV 1770132 [Actual condition of sperm donation] Department store receptionist wife 25 years old [Sweet beautiful voice] SNS ＃ Married woman who came by sperm donation vaginal cum shot! Head bug in the first cock uterus kiss Ahegao convulsions Acm

  • amateur uncensoredfc2
    • 2021-04-19
    115 min

    [083PPP-2119]デカパイ熟女10人！乳房ブルンブルン鬼イキ爆ハメDX(5)

  • amateur censoredbig titsmarried womanpppppp-2119ppp2119083ppp-2119
    • 2021-04-21
    51 min

    492JCHA-010 JK Fresh Erotic Oil Massa Treatment 4

  • amateur censoredbig titsuniformjchajcha-010jcha010492jcha-010
    • 2021-04-22
    24 min

    FC2PPV 1778421 [Personal shooting] Licking a big pie ♡ Maid clothes Tecateka panties mass bukkake!

  • amateur uncensoredfc2
    • 2021-05-07
    59 min

    230OREC-756 Yukino

  • amateur censoredcreampieamateurorecorec-756orec756230orec-756
    • 2021-05-20
    122 min

    [IENF-142]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 2

  • aina hayashi rina takase censoredcreampieamateurIENFienergytiger kosakaiienfIENF-142IENF1421ienf00142
    • 2021-05-20
    120 min

    [ARSO-21146]My Wife -Celeb Club- 146

  • masaru momose miu nonomura censoredblowjobARSOaroundARSO-21146ARSO21146h-1378arso21146
    • 2021-05-23
    63 min

    FC2PPV 1832637 An executive of a fast-growing rumored venture company and a miracle H ❤️❤️ I have vaginal cum shot twice as I desire ❤️❤️

  • amateur uncensoredfc2
    • 2021-06-11
    124 min

    [DASD-875]Thanks For The Stepmom/Stepdaughter. I Knocked The Stepmom Up Decades Ago, Now It's The Stepdaughter's Turn. Michiru Kujo Kotone Toa

  • kujo michiru toua kotone censoredmature womanbeautiful girlDASDdaschinpo dazaiDASD-875DASD875dasd00875
    • 2021-06-16
    119 min

    [TPPN-197]Ultimate First Ascension! Aoi Mukai She's Lost Her Mind! Wet Grinding Private Parts Bursting With Pussy Juice Sex So Wild That It Put Her In A Trance

  • ai mukai censoredblowjobsingle workTPPNteppanTPPN-197TPPN197tppn00197
    • 2021-07-02
    37 min

    480FRIN-039 [Otsuka] Mature Woman Deriheru Hidden Shooting-A Young Man Will Get Creampie Raw Production OK [42 Years Old G Cup]

  • amateur censoredcreampiebig titsfrinfrin-039frin039480frin-039
    • 2021-07-09
    118 min

    [EBOD-841]When Mother's Not Around... Big Tits Hostess Repeatedly Made to Cum During Coronavirus Crisis by Fat Customer's Peerless Dick... Mina Kitano

  • mina kitano censoredcreampiebig titsEBODe bodykitorune kawaguchiEBOD-841EBOD841ebod00841
    • 2021-07-15
    127 min

    [TOEN-045]A Mature Female Teacher Had Forbidden, Orgasmic Sex With A S*****t, And That Incident Lifted The Brakes Off Any And All Reason, Leading Her To Lose Her Mind On Her Days Off, She Would Bring Him To Her House, And They Would Have Furious Sex

  • yukie mizukami censoredcreampiemature womanTOENcenter villageyoichi sanotaoyuanTOEN-045TOEN045h-086toen00045



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online