def office lady censored jav creampie




FC2MVSDHUNTBHDKAJUFESPRDKSBJMILKSQTEAWDMIDEPPPDNACRSANPREDCHRVGMEMSHKDDTTAPODHND

2020-12-17
53 min

FC2PPV 1610069 [Uncensored] S-class small devil J ● Miss Refre Misa and flirting raw vaginal cum shot SEX !! J ● Miss Refre: Misa (18 years old) ②

  • amateur uncensoredfc2
    • 2020-12-17
    167 min

    [MVSD-449]Shy About Her Cleavage - Busty Babe Insecure About Her Huge Tits Has Them Rubbed And Squeezed To An Intense Squirting Orgasm! Tomoko Kamisaka

  • tomoko kamisaka censoredbig titssquirtingMVSDm s video groupMVSD-449MVSD449mvsd00449
    • 2020-12-20
    158 min

    [MISM-191]Consultant Trainee Gets Her Asshole Stretched Wide Open Too Much So That It Won't Close

  • censoredanalMISMm girls labinaballMISM-191MISM191mism00191
    • 2020-12-20
    117 min

    [JUL-415]The Boss's Wife Is Turning Me On And I Don't Think She Knows It - Clothed Sex With Her Voluptuous Body - She's Even Sexier This Way Than Naked. Rin Okae

  • rin okae censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-415JUL415jul00415
    • 2020-12-27
    121 min

    [KSBJ-111]A Beautiful Married Woman Who Was Made To Repay Her Husband's Debt With Her Body - Natsu Nishida

  • natsu nishida censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-111KSBJ111ksbj00111
    • 2021-01-09
    147 min

    [IPX-601]My Girlfriend Is A Smoking Hot Lingerie Model - Corrupted By Her Own Employer, Made To Fuck On Film Nanami Misaki

  • nanami misaki censoredlingeriesingle workIPXidea pocketdishIPX-601IPX601ipx00601
    • 2021-01-15
    105 min

    483SGK-010 [Unprecedented frenzy climax] [Raw Saddle 2 barrage] [Amazing convulsions] [Big breasts big butt] [G-cup] A pair of late mega gifts! !! Unprecedented! Transcendental agony! Infinite convulsions! Santa Claus is coming down! The butt that sw

  • amateur censoredcreampiebig titssgksgk-010sgk010483sgk-010
    • 2021-02-17
    59 min

    SIRO-4428 [First shot] [Cool girlfriend ..] [Smeared in cloudiness] A serious girl with a cool reaction actually made a big stain on her underwear. Honest body seeks pleasure .. AV application on the net → AV experience shooting 1466

  • amateur censoredamateursirosiro-4428siro4428siro-4428
    • 2021-02-20
    97 min

    [IMOTA-008]I Tried To Make My Nerdy Loser Stepsister A Little Sexier And She Transformed Into A Raging Slut. Aria Aimi

  • aimi censoredblowjobsisterIMOTAstar paradisesister eggIMOTA-008IMOTA008h-254imota00008
    • 2021-02-21
    149 min

    [CAWD-180]I Secretly Removed My Rubber And Ended Up Breaking Her Ban On Creampie Sex And Raw Fucking Without Permission 15 Consecutive Creampie Cum Shots Without Ever Pulling Out In A Fantastic Feat Of Fucking That Would Burn This Moment Of Ultimate

  • yume kotoishi censoredcreampiebeautiful girlCAWDkawaiirakudaCAWD-180CAWD180cawd00180
    • 2021-02-26
    106 min

    [GNAX-047]Prim And Proper Young Wife Receives Sex Ed From Perverted Old Man - The Illicit Sex Only Her Husband Doesn't Know - Ran Shiono

  • ran shion censoredcreampiebig titsGNAXnagirateijagaGNAX-047GNAX047h-1345gnax00047
    • 2021-02-27
    60 min

    SIRO-4429 [First shot] [Flowing delicate body] [Penetrating big cock ..] A professional student who wants to make up, fascinating cuteness like a small animal. It must have been a revenge for the boyfriend who was cheating .. AV application on the ne

  • amateur censoredamateursirosiro-4429siro4429siro-4429
    • 2021-02-28
    56 min

    230OREX-213 Ruka san

  • amateur censoredcreampiebig titsorexorex-213orex213230orex-213
    • 2021-03-05
    66 min

    [SZKK-023]That Our Stepdaughter Would... - R-18/Minori Kurada

  • suzumiya kotone censoredsoloworkSZKKorustak softmasturbation supportSZKK-023SZKK023
    • 2021-03-11
    133 min

    [HAWA-240]"I Don't Want To Be A Stepmother, I Want To Be Treated Like A Woman ..." While Nursing, Even Though She Has A C***d, She Was Receiving Creampie Sex From A Strange Man And Exposing Her Pig-Face Expressions Of Orgasmic Pleasure Wh

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-240HAWA2401hawa00240
    • 2021-03-21
    154 min

    [CAWD-198]Pale, Smooth Skin And Perky Nipples... This Young Teen Is Still Developing - Halfway Between A Girl And A Woman - Former C***d Star Hinano Aiuchi - Her One And Only Porn Debut

  • aiuchi hinano censoreduniformsingle workCAWDkawaiikannana dainanaCAWD-198CAWD198cawd00198
    • 2021-03-25
    61 min

    Pacopacomama 032521_451 The Training For Wife: Kimono Beauty In Acrobatic Hardcore Kana Miura

  • amateur uncensoredpacopacomama
    • 2021-03-26
    35 min

    HEYZO 2507 As You Like It – A Shaved Runaway Girl With Inverted Nipples Vol.01- – Saki

  • saki uncensoredheyzo
    • 2021-04-17
    140 min

    [JUL-555]An Ultra Orgasmic And Horny G-Cup Titty Slut Has Cum Down To Bless Us All!! This Married Woman Receptionist Has Joined All Of The Men In The Office Together As Fellow Pussy Posse Members Tachibana-san (Not Her Real Name) 30 Years Old

  • censoredcreampiebig titsJULmadonnaJUL-555JUL555jul00555
    • 2021-04-18
    143 min

    [APKH-171]A Spoiled Brat Perverted Bitch! She Attends A College Located Near The Metro Station Line That Departs From Shinjuku, And While Commuting From Cock To Cock, She's Cumming On A Daily Basis #Crazy For Sugar-Daddy-Hunting Sex Nagi Kamo

  • kamo nagi censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-171APKH171apkh00171
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    120 min

    [PRED-309]Her Ass Is Susceptible To Suggestion. I Lost My Mind Over That Beautiful Ass Belonging To The Girl Next Door, And I Kept On Pumping Her With Piston-Pounding, Out-Of-Control Creampie Sex ... Kano Kashii

  • kashii hanano censoredcreampiesingle workPREDpremiumeightelegancePRED-309PRED309pred00309
    • 2021-05-07
    62 min

    [NTTR-062]A Female Employee I Switched Bodies With Asumi Yoshioka And Now I Get To Have Al The Sex I Want In The Office! I Reverse Fucked My Own Body And Streamed It Live LOL

  • yoshioka asuka censoredcreampiebig titsNTTRsod createben katoknotriNTTR-062NTTR0621nttr00062
    • 2021-05-17
    77 min

    259LUXU-1394 Luxury TV 1405 Big Breasts Gravure Who Was Fascinated By Having Sex While Being Taken In The Last Shooting And Playing Only In AV Is Re-Appearing! !! Unleashed from her tension, she is enthusiastic about blaming herself this time. She le

  • amateur censoredbig titsamateurluxuluxu-1394luxu1394259luxu-1394
    • 2021-05-22
    106 min

    [APNS-241]Married Cook At The Worker's Temporary Quarters Used As A Sex Toy Mia Hanesaki

  • mia hasaki censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-241APNS241apns00241
    • 2021-06-01
    69 min

    H0930 ki210601 Miki Ide 30years old

  • amateur uncensoredh0930
    • 2021-06-12
    120 min

    [NATR-659]Father Fucks His Son's Wife In His Fantasies Nanako Miyamura

  • nanako miyamura censoredcreampiemature womanNATRnadeshikobito sakuraNATR-659NATR659natr00659
    • 2021-06-12
    164 min

    [SABA-702]Challenge The Mission - Angelically Sweet Nurse Breaks In A Male Virgin! He Suckles Her Tits While She Gives Him A Handjob! It Starts With Blushing Thigh Sex, Then His Cock Slips Inside SPECIAL vol. 001

  • censoredcreampieblowjobSABAskyu shirototodoSABA-702SABA702saba00702
    • 2021-06-17
    53 min

    C0930 ki210617 Reiko Hayami 43years old

  • amateur uncensoredc0930
    • 2021-07-01
    60 min

    Pacopacomama 070121_497 Secret with the wife next door Reiko Shibata

  • amateur uncensoredpacopacomama
    • 2021-07-09
    141 min

    [MIDE-949]The Devilish Stepsis Lolita Seduces me Alone With Her, Hugging Her Tightly as We Slowly Fuck, Still Dressed in Our Sticky Clothing! Mia Nanazawa

  • nanasawa mia censoredbeautiful girlslutMIDEmoodyzsamoarimoodyz divaMIDE-949MIDE949mide00949
    • 2021-07-28
    109 min

    435MFC-127 [Gonzo Junky Innocent Dochashiko Beauty] The Side Dish Of Masturbation Is My Own Gonzo Video I Have Taken So Far! ？？ Super Kinky Gonzo Addict Marina-Chan And Guchogucho Cum Sex ♪ Rich Second Round That Shakes A Sensitive Body With Huge Bre

  • amateur censoredcreampiebig titsmfcmfc-127mfc127435mfc-127
    • 2021-07-29
    125 min

    [JRZE-065]First Time Filming My Affair - Chihiro Shinozuka

  • chihiro shinozuka censoredcreampiemature womanJRZEcenter villagemitsusato koutaroushoku ureJRZE-065JRZE065h-086jrze00065
    • 2021-08-13
    35 min

    FC2PPV 2008456 First Shot! !! Appearance! !! Limited Number! [Uncensored] Overwhelming Beauty And A Lascivious Look … Creampie Twice In A Famous Ecup Beauty Who Is Full Of Charm! !! (Feature Film)

  • amateur uncensoredfc2
    • 2021-08-15
    56 min

    FC2PPV 2028583 [Top Secret Video] Complete Appearance! A Slender Beautiful Girl Who Has Just Moved To Tokyo At The Age Of 18 And Is At The Level Of Noosaka! A Top Secret Video Of Two Consecutive Vaginal Cum Shots Before The Idol Trainee Debuts!

  • amateur uncensoredfc2
    • 2021-08-22
    40 min

    FC2PPV 2060301 [Amateur ❤ Creampie] It Was Said That It Would Be Best If You Had A Raw Fuck With A Married Woman In A Sauna & Open-Air Bath ❤ 18th Work [Sauna & Open-Air Bath]

  • amateur uncensoredfc2
    • 2021-09-28
    71 min

    324SRTD-0246 Cheating Video Shooting To Attract Your Boyfriend! ？？ I Should Have Forgotten The Purpose And I’m Serious! (Moe Hazuki)

  • amateur censoredcreampieamateursrtdsrtd-0246srtd0246324srtd-0246
    • 2021-10-08
    244 min

    [VENX-082]Meet The S*****t Council Brats Who Group Fucked Their Hot Teacher And The Sexy PTA Chairwoman Honoka Kimura & Yuri Mizukawa

  • censoredcreampiemature womanVENXvenusincest vi nasuVENX-082VENX082venx00082
    • 2021-10-09
    58 min

    H4610 gol207 Nana Tominaga 20years old

  • amateur uncensoredh4610
    • 2021-10-14
    62 min

    336KNB-176 A Beautiful Wife Who Decides To Appear In An AV And Shakes A Ripe Erotic Body And Drowns In Sex With Other Than Her Husband. 69 At Miyahara Station, Saitama City, Saitama Prefecture

  • amateur censoredbig titsmarried womanknbknb-176knb176336knb-176
    • 2021-10-22
    180 min

    [HUNBL-066]Step Mother Held For Her Son" Sake

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-066HUNBL066hunbl00066
    • 2021-10-22
    93 min

    [VEC-501]Wife Betrayed By Mom Friend And Creampied By Scum, Minami Nagata

  • minami nagata censoredcreampiemature womanVECvenustamatsuka bingomegami venusVEC-501VEC501vec00501
    • 2021-10-29
    120 min

    [CAWD-308]Nipple Teasing With B.B Boys Is Critical Hit! Full Throttle Nipple Teasing With Full Smash Beautiful Girl! Hina Hanae

  • hanayo hina censoredsluthandjobCAWDkawaiioosaki hirokoujiCAWD-308CAWD308cawd00308
    • 2021-11-25
    121 min

    [HBAD-602]妖艶な弟の嫁に禁断の中出し夜●い 凛音とうか

  • roaring sound censoredcreampiesingle workHBADhibinounicorn fukudababeHBAD-602HBAD6021hbad00602
    • 2021-12-11
    135 min

    [CEMD-095]A Taxi Driver Slut 4 Kiu Aihara Underneath Her Uniform, She"s Hiding Her Horny Body, But Now This Hard-Driving Slut Is Ready To Enjoy Some Big Banging Sex With A Big Dick!

  • aihara tsukiha censoredbig titsmature womanCEMDserebu no tomoCEMD-095CEMD095cemd00095
    • 2021-12-27
    107 min

    [298JSTK-014]独占DEBUT 初撮り初女装 Reina

  • amateur censoredamateurjstkjstk-014jstk014298jstk-014



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online