global media annex




FC2CESDCJODMILKHMNNACRMIDVHNDSSNIDASDSQTEADNSANWANZPPPDDASDIPXMIDEBBANMIAAONEZ

2020-09-10
118 min

[EKDV-642]Aoi Kururugi At The Hot Spring Resort

  • aoi kururugi censoredcreampieblowjobEKDVcrystal eizokenichi otae kissEKDV-642EKDV64249ekdv00642
    • 2020-09-10
    81 min

    [REBD-492]Yuna 3: Everything Erogenous/Yuna Ogura

  • yuna ogura censoredsingle workREBDrebeccachikara sawamuraREBD-492REBD492h-346rebd00492
    • 2020-09-11
    141 min

    [NASH-360]Forbidden Creampie Nurses Love Lower Body Caretaking, 5 Married Women

  • censoredcreampiebig titsNASHnadeshikomidori yamamuraNASH-360NASH360h-067nash00360
    • 2020-09-18
    240 min

    [AQMB-020](I Couldn't Believe My Adorable Wife Was Doing Such Lusty Things...)

  • censoredcreampiemature womanAQMBaquamall herowhite moleaquamallAQMB-020AQMB020aqmb00020
    • 2020-09-22
    31 min

    FC2PPV 1510528 Saddle shot of a 20-year-old erotic cute beauty who specializes in back dancers

  • amateur uncensoredfc2
    • 2020-09-26
    118 min

    [MIMK-074]Her Pussy Has Been Penetrated! But Now I Can't Pull Out!？ - How To Go Through Everyday Life While Fucking - Amy Fukada

  • emi fukada censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-074MIMK074mimk00074
    • 2020-09-27
    129 min

    [JJAA-039]A Married Woman Takes An Employee Into The Break Room At Her Part Time Job For Some Private Fun 14

  • censoredcreampiemature womanJJAAjukujo japanJJAA-039JJAA039jjaa00039
    • 2020-09-29
    45 min

    FC2PPV 1517731 * First appearance 1st place * Limited [Individual / Uncensored] 20-year-old neat younger sister shaved student, a hidden bitch who keeps holding a dick and a large amount of raw vaginal cum shot [Amateur, outflow strictly prohibited]

  • amateur uncensoredfc2
    • 2020-10-08
    47 min

    C0930 ki201008 Minami Tanda 56years old

  • amateur uncensoredc0930
    • 2020-10-25
    129 min

    [ONSG-028]Big Tits Derriere, Ryo Arimori

  • ryo arimori miyu tokohara censoredcreampiebig titsONSGgain corporationONSG-028ONSG028onsg00028
    • 2020-11-01
    119 min

    [JKNK-114]If You Suddenly Show Off To A Married Woman In The Middle Of Shopping...

  • censoredmature womanJKNKjuku no kura emmanuellejuku no kuraJKNK-114JKNK114jknk00114
    • 2020-11-07
    51 min

    Pacopacomama 110720_381 Kaori Hanayama

  • kaori hanayama uncensoredcreampieblowjobpacopacomama
    • 2020-11-12
    129 min

    [NEO-744]Big Tits & Armpit Teasing Nene Tanaka

  • nene tanaka censoredbig titsbeautiful girlNEOradixshio sakurabaneo paradoxNEO-744NEO744433neo00744
    • 2020-11-19
    160 min

    [SSNI-926]Pleasure! First Experience Multiple Orgasms 3 Fuck Scenes: Younger "Elder Sister"-Type Girl Get Totally Immersed In Wild New Sex - Mai Shiomi

  • mai shiomi censoredbeautiful girlsingle workSSNIs1 no 1 styletrendy yamaguchiSSNI-926SSNI926ssni00926
    • 2020-11-19
    240 min

    [PAP-204]You'd Never Guess Their Age! Freakishly Good-Looking Mature Beauties With Amazing Bodies Who Love To Fuck Japanese Guys - Sex With Blonde-Haired MILFs 4 Hours 9 Girls

  • censoredmature womanPAPrubyjukunenPAP-204PAP204pap00204
    • 2020-11-29
    66 min

    407KAG-112 Pari Pigal is thrown in a big dick and female climax! !! Unintentional discharge to the foolery of saffle who awakens her true nature ww

  • amateur censoredcreampieamateurkagkag-112kag112407kag-112
    • 2020-12-02
    137 min

    [GVH-156]The Sexy PTA Chairwoman & A Mind-Blowing Hot Teacher Get Teamed By The S*****t Council Brats Ayane Sezaki/Mizuki Yayoi

  • ayane sezaki mizuki yayoi censoreddramaGVHglory questhyonGVH-156GVH15613gvh00156
    • 2020-12-09
    80 min

    FC2PPV 1599806 [Limited to 3 days] I really did it when I persuaded a black gal dancer & Ibecon woman (^ _-)-☆

  • amateur uncensoredfc2
    • 2020-12-22
    140 min

    [IBW-806]Nature Classroom, A Tanned Beautiful Girl's Obscene Video

  • amateur censoredbeautiful girlIBWi b worksIBW-806IBW806
    • 2020-12-26
    112 min

    390JAC-073 [God Iki Goddess x Big Breasts H Cup x Raw Saddle 4 Barrage] “My wish is to squeeze all sperm” Ultimate H huge breasts gal who fell down on the gal! !! Explosion! convulsions! Great cum! I repeat it over and over again! !! I don&

  • amateur censoredcreampiebig titsjacjac-073jac073390jac-073
    • 2020-12-31
    66 min

    FC2PPV 1626933 [Uncensored] I can’t forget the old man’s dick !! SEX with a rich vaginal cum shot in a frustrated pussy by reuniting with an S-class beauty OL !! OL: Marin-chan (21 years old) ②

  • amateur uncensoredfc2
    • 2021-01-15
    160 min

    [MDBK-151]What a Coincidence! The Hooker They Sent Me Was the Girl I Jerked off to in High School! Cumming Ensues!! 5

  • nanase mona yuri fukada censoredcreampieschoolgirlMDBKbazookak taroMDBK-151MDBK151h-1496mdbk00151
    • 2021-01-30
    152 min

    [MIAA-383]When All Is Said And Done, I Love My Wife! Our Marriage Hit The Rocks, But When We Had Sex For The First Time In Years... Our Bodies Fit Like A Hand In A Glove, And We Fucked Like Crazy, Over And Over, Until The Break Of Dawn!! Kurea Hasumi

  • hasumi claire censoredcreampieblowjobMIAAmoodyzsapporo taroeveryone s porn starMIAA-383MIAA383miaa00383
    • 2021-02-21
    160 min

    [DASD-806]A Hot And Horny Girl Who Loves Sports. It Was Supposed To Be An Idol Video Shoot, But They All Jumped The Gun And Turned It Into An Adult Video Fuck Fest. Toa Nanashima Toa Nanashima

  • toai nanami censoredbeautiful girlsingle workDASDdasrokusaburo mishimaDASD-806DASD806dasd00806
    • 2021-03-04
    113 min

    [AKDL-090](Amateur Interview) Secretly Appearing In A Porno "Pussy Hair Bobo-chan" 24 Year Old Dental Assistant Loves Riding Cowgirl Style

  • censoredamateurslutAKDLaquinoriaquinoriaknrAKDL-090AKDL0901akdl00090
    • 2021-03-05
    241 min

    [HODV-21560]Sachiko Best Hits Collection

  • sachiko censoredcreampiebig titsHODVh m pHODV-21560HODV215605642hodv21560
    • 2021-03-10
    30 min

    FC2PPV 1720491 [First shot / OL] New ● 23-year-old working at Corsen is the first cum swallowing at Magic Mirror House

  • amateur uncensoredfc2
    • 2021-03-26
    118 min

    [MIDE-906]My Brother's Wife Always Looks Down On Me, But When I Found Out About Her Secret Part-Time Job As A Soapland Hooker, The Tables Were Turned! I Blackmailed Her Into Taking My Creampie Mizuki Aiga

  • mizuki ai censoredcreampiesingle workMIDEmoodyzhiroamoodyz divaMIDE-906MIDE906mide00906
    • 2021-03-28
    56 min

    230OREX-231 Yuria (M cup)

  • amateur censoredcreampiebig titsorexorex-231orex231230orex-231
    • 2021-04-02
    58 min

    FC2PPV 1743341 [Personal shooting] Kanade 32 years old Massive launch to a sweat duck beautiful wife with outstanding style F cup beauty big tits

  • amateur uncensoredfc2
    • 2021-04-28
    82 min

    FC2PPV 1792544 [2980 → Limited number 1980] Fifty slender wife ❤️ Sexless for childcare for housework ❤️ Secret libido release at home ❤️ Massive raw vaginal cum shot in honey pot pussy with a meat stick other than her husband ❤️ * Bonus / Onafera 27

  • amateur uncensoredfc2
    • 2021-04-30
    97 min

    380SQB-099 Saya

  • amateur censoredamateursqbsqb-099sqb099380sqb-099
    • 2021-05-08
    122 min

    [XRL-005]Disciplining A Beautiful Young Wife With Debt Problems With Dirty Talk Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobsingle workXRLreal worksreal real worksXRL-005XRL005xrl00005
    • 2021-06-02
    88 min

    300MAAN-659 [Sweat Duck x Orgy] "Sayaka-san"’s Marunage Request! Soul and soul full sex! Eat steak and keep shaking your hips as long as you keep fit! Massive squirting inevitable lack of water! Enjoy long-time sex in a state of sweat, t

  • amateur censoredcreampiesquirtingmaanmaan-659maan659300maan-659
    • 2021-06-04
    82 min

    [YMDS-032]Young Lady's Catering Service! Angelic Little Ena (K-Cup)'s Devilish Bouncy Big Tits! Ena Koume

  • ena koume censoredcreampiebeautiful girlYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-032YMDS032ymds00032
    • 2021-06-06
    90 min

    300NTK-583 Active Gravure Superb Style G Breasts! !! Start from wearing erotic shooting! !! It is inevitable to induce a good desire in a swimsuit with no cloth area of a beautiful woman who can push it completely! !! Heat with sexy pose instruction!

  • amateur censoredcreampiebig titsntkntk-583ntk583300ntk-583
    • 2021-07-18
    243 min

    [NASH-544]Horny Mature Women! Works Carefully Selected By Our Stuff ! Piss Juices Overflowing To The Max! You Will Definitely Get Off! 4 Hours Of Older Women Having Thick, Rich Sex

  • censoredcreampiebig titsNASHnadeshikoNASH-544NASH544nash00544
    • 2021-08-12
    206 min

    [NHDTB-562]Miniskirt High School Groping, Fucked From Behind With Her Short Skirt Turned Up

  • censoredNHDTBnatural highsakurai vanillaNHDTB-562NHDTB5621nhdtb00562
    • 2021-08-13
    151 min

    [SSIS-157]I Have Nothing But Contempt For My Boss, But To My Surprise, During Our Business Trip, We Were Booked Together Into The Same Room ... This New Employee With H-Cup Titties Unexpectedly Found Herself Enjoying The Orgasmic Sex That Kept On Goi

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylenikusonSSIS-157SSIS157ssis00157
    • 2021-08-18
    125 min

    [GVH-274]Naughty Nurses Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-274GVH27413gvh00274
    • 2021-08-19
    72 min

    [AKDL-133]KDK [Kudoki] I Convinced This Woman. Real Estate Saleswoman, 23 Years Old - Rua Takashiki

  • takashiki censoredbig titsAKDLaquinoriaquinoriaknrAKDL-133AKDL1331akdl00133
    • 2021-08-20
    120 min

    [HMN-032]"Cum Inside Me For Free" Big Tittied Wife Seeking Young Men"s Sperm To Have A C***d Behind Her Husband"s Back, Starring Ai Sayama

  • sayama love censoredcreampiebig titsHMNhonnakakitorune kawaguchiHMN-032HMN032hmn00032
    • 2021-08-26
    62 min

    SIRO-4609 [First Shot] [Whitening Slender Body] [Petite X Delicate] A Slender Female College Student With A Cute Smile. Shake The Delicate Body To The Advance Of The Phallus That Echoes To The Back .. AV Application On The Net → AV Experience Shootin

  • amateur censoredamateursirosiro-4609siro4609siro-4609
    • 2021-09-01
    45 min

    [090121-001][VR] Blowjob and riding sex in the bathroom

  • emi sakurai uncensoredcreampiehandjobcaribbeancom
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-25
    70 min

    FC2PPV 2203916 For A Limited Time [Stealing X Shooting] Appearance: Big Breasts J ● Daddy Live Dashcam Data Leaked Toshima Ward [Car Sex]

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online