gonzo glasses squirting beautiful tits doggystyle




FC2IPXNACXGVHBBANHDKAEBODNGODATIDCHRVDASDCAWDROYDJULFSDSSCESDSTARSHMNMIDVWAAAPPPD

2020-09-09
30 min

FC2PPV 1497020 * With review bonus video * [☆ God style ☆] 170 cm tall G cup metamorphosis gal! I feel too much! Roll up! Because it was too erotic, vaginal cum shot special ☆ uncensored ☆

  • amateur uncensoredfc2
    • 2020-09-22
    130 min

    [STARS-265]Suzu Honjo A Condom I Had With Me (For My Boyfriend To Use) In A Shared Room With A Virgin Boy Subordinate On A Business Trip... I've Only Got Just The One... He Asked Me To Fuck Him Just One Time, But Got Too Excited And Creampied Me

  • suzu honjo censoredcreampiesingle workSTARSsod createryo inugamisod starSTARS-265STARS2651stars00265
    • 2020-09-24
    479 min

    [CADV-783]Crystal Films 35th Anniversary - School Swimsuit Sex - 30 Girls, 8-Hour Special

  • bud aika censoredbig titssquirtingCADVcrystal eizocrystal exCADV-783CADV78349cadv00783
    • 2020-10-10
    130 min

    [BNST-018]Fuck! Uniform Bitch With Nipples Coming Out - Natsuki Kisaragi

  • natsuki kisaragi censoredbig titsuniformBNSTteacher mousouzokusamoariBNST-018BNST018bnst00018
    • 2020-10-27
    78 min

    [MCKT-004]My Deathly Cute Fuck Buddy

  • censoredMCKTchikikikikama delusion groupMCKT-004MCKT004mckt00004
    • 2020-11-13
    58 min

    FC2PPV 1565250 [No] Manaka-chan, a daddy active girl, is usually shy and neat, but she suddenly changes with etch and is very satisfied with her uncle and vaginal cum shot. 【selfie】

  • amateur uncensoredfc2
    • 2020-11-13
    151 min

    [MIFD-136]Shy Computer Programmer With No Friends At Work Wants To Become Japan's Kinkiest Slut Suzuka Ninomiya

  • ninomiya suzuka censoredblowjobbeautiful girlMIFDmoodyzusa pyonmoodyz freshMIFD-136MIFD136mifd00136
    • 2020-11-19
    77 min

    299EWDX-333 Healing K Cup Newlyweds, but my husband can only seed twice a month

  • amateur censoredcreampiebig titsewdxewdx-333ewdx333299ewdx-333
    • 2020-11-25
    57 min

    [orec-632]ひかりさん

  • amateur censoredamateurorecorec-632orec632orec-632
    • 2020-12-02
    135 min

    [GVH-158]Anal Teacher II Akari Niimura

  • akari shinmura censoredanalslutGVHglory questchintaGVH-158GVH15813gvh00158
    • 2020-12-04
    128 min

    [HODV-21531]"We Just Missed The Last Train Home... Do You Want To Cum Over？" After Missing My Last Train Home, I Ended Up Spending The Night At My Lady Boss' Place, And Since Her Husband Was Away On Business, We Ended Up Committing Adulte

  • ai mukai censoredcreampieslutHODVh m pinugami ryouHODV-21531HODV215315642hodv21531
    • 2020-12-17
    115 min

    [BLK-480]Hot Gal In Uniform Has Sweaty, Greasy Sex With An Older Guy (Sugar Daddy) Who Loves To Kiss Her Himari Kinoshita

  • himari kinoshita himari hanazawa censoreduniformschoolgirlBLKkira kirakira kira black galBLK-480BLK480blk00480
    • 2020-12-31
    101 min

    [ADN-282]The Days I Spent Nailing The Horny Married Slut At My Job. Kana Kusakabe

  • kana kusakabe censoredbig titssingle workADNattackerssadao sadaokaotona no dramaADN-282ADN282adn00282
    • 2021-01-03
    47 min

    FC2PPV 1630188 Rikako, a Roppongi lounge girl who was deceived by a massage recruitment and abandoned her pride ❤️ Raw squirrel to a slender beauty who stays high ❤️ A sticky villa villa that was used in the pillow business There is a purchase privil

  • amateur uncensoredfc2
    • 2021-01-05
    134 min

    [STARS-314]Clothed Shameful Submersion Totally Clothed And Secret Camera Angles Yuna Ogura

  • yuna ogura censoredschoolgirlsingle workSTARSsod createbacon tanakasod starSTARS-314STARS3141stars00314
    • 2021-01-24
    119 min

    [NSPS-963]Going Crazy Aged 20. Living Together Half The Time: Hot Steamy Sex Between Middle-Aged Old Man And His Young Step-Daughter - Sachiko

  • sachiko censoredsingle workdramaNSPSnagae stylejotaro tomiNSPS-963NSPS963nsps00963
    • 2021-01-29
    168 min

    [NIKM-053]The Inner Masochist Awakens! Ultimate Big Tits Masochist Woman's Stigmatization, With Yuria Yoshine

  • yoshine yuria censoredbig titssingle workNIKMnikumoripiNIKM-053NIKM053h-1323nikm00053
    • 2021-01-29
    60 min

    [OTIM-055](Online Only) (Daydream POV) No Makeup Morning Sex With Your Loving Girlfriend Aoi Nakajo

  • nakagusuku censoredcreampieblowjobOTIMprestigeonetimeOTIM-055OTIM055118otim00055
    • 2021-02-05
    240 min

    [HODV-21552]Best Of Mizuki Yayoi

  • mizuki yayoi censoredcreampiebeautiful girlHODVh m pHODV-21552HODV215525642hodv21552
    • 2021-02-07
    51 min

    FC2PPV 1676684 [Personal shooting] No.028 Kana-chan ★ G cup glamorous body again. The cute and charming girls’ etch is the best ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2021-02-11
    54 min

    FC2PPV 1681410 First shot ❤️ Get a big tits slender white-skinned natural girl with TikTok! Cheating Dick Raw Saddle SEX While Calling With Boyfriend → Unauthorized Seeding In The Vagina As It Is Massive Creampie! [Personal shooting] With benefits

  • amateur uncensoredfc2
    • 2021-03-11
    68 min

    FC2PPV 1720961 [Complete amateur 94] Akane 19 years old Part 2, complete appearance, full-scale SM training started for G cup beautiful girl!

  • amateur uncensoredfc2
    • 2021-03-18

    FC2PPV 1731298 Limited to 21 [Uncensored] JD with one experienced boyfriend, first vaginal cum shot with sex for the first time in a long time

  • amateur uncensoredfc2
    • 2021-03-26
    118 min

    [CLUB-634]I Fell In Love With A Cheerful Slut And Seduced Her By Pretending I Was A Virgin. She Couldn't Help But Want To Break In A Sweet, Shy Boy Like Me And The Moment My Cock Met Her Big Tits She Fell In Love With My Erection. Part Two.

  • censoredbig titsuniformCLUBhentai shinshi clubCLUB-634CLUB634club00634
    • 2021-03-31
    45 min

    292MY-446 Natsuki Nakano 2

  • amateur censoredcreampiemarried womanmymy-446my446292my-446
    • 2021-04-10
    111 min

    [VENX-024]Step Family G*******g My Beautiful Step Aunt Akane Shiki

  • akane shiki censoredcreampiemature womanVENXvenussarufakecest winntersVENX-024VENX024venx00024
    • 2021-04-17
    162 min

    [JUL-548]Glisteningly Gorgeous. This Married Woman Draws Every Man's Eye At The City Pool - Toko Amemori, Age 34, Porn Debut!

  • toko amemori censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-548JUL548jul00548
    • 2021-05-08
    48 min

    H0930 ki210509 Machiko Nishizaki 30years old

  • amateur uncensoredh0930
    • 2021-06-02

    FC2PPV 1849089 Limited price until 7th [Uncensored] Get out of the OL work of glasses and cum inside a secret meeting at the hotel

  • amateur uncensoredfc2
    • 2021-06-17
    97 min

    [MYBA-035]The Blooming Of A Wife - Nanami Mineda

  • nanami mineda censoredmature womansingle workMYBAhitozuma engokai emmanuelleihyo kairoiMYBA-035MYBA035myba00035
    • 2021-06-20
    154 min

    [DGCEMD-028]Online Exclusive! With Special Bonus Footage - Pushed To Her Limit With Nipple Teasing! Her Sensitive Tits Experience The Ultimate Pleasure! Mao Watanabe

  • mao watanabe censoredcreampieblowjobDGCEMDcelebrity friendsDGCEMD-028DGCEMD028dgcemd00028
    • 2021-06-26
    51 min

    C0930 tk0037 Syoko Misawa 27years old

  • amateur uncensoredc0930
    • 2021-07-08
    108 min

    [FGAN-044]Private Use Panty Shot Doll Hono

  • censoredcosplayFGANfechi mefetish eyesFGAN-044FGAN044h-1440fgan00044
    • 2021-07-09
    139 min

    [EBOD-839]Ultimate Skinny Big Boobs Extreme Beauty Proportions Mistress Shakes Her Hips So Hard It Looks Like She'll Break Them Hedonistic Mating Adultery Trip Miyuki Arisaka

  • arisaka miyuki censoredcreampiebig titsEBODe bodymishima rokusaburoEBOD-839EBOD839ebod00839
    • 2021-07-15
    119 min

    [HALE-005]Devouring Young MILFs: Infinite Loop Vol. 5 Rika - Cute Face, Big Booty, Screaming Orgasm, Semen-Swilling MILF

  • censoredbig titsamateurHALEhalentino daydream tribehalentinoinfinite loop eating my mom s frienHALE-005HALE005hale00005
    • 2021-08-06
    146 min

    [IPX-702]-KANZETSU- Developing The G-Spot! Limit-Breaking Extreme Orgasmic FUCKING!! Great Shower Of Squirt!! Rio Kuriyama

  • rio kuriyama censoredsquirtingblowjobIPXidea pocketmaeda no kahoritissueIPX-702IPX702ipx00702
    • 2021-08-09
    58 min

    1Pondo 080921_001 Piledriver BJ, Special Edition 18 Miku Aoyama Ryoka Sakurai Rena Hiiragi

  • amateur uncensored1pondo
    • 2021-08-13
    70 min

    518ASGM-015 [Daddy Live JK / Intravaginal Ejaculation] Famous Lady School Jk (Private / Regular Course / Back Op) D Cup

  • amateur censoredcreampieamateurasgmasgm-015asgm015518asgm-015
    • 2021-09-24
    152 min

    [DASD-918]Demanding Licking And Sucking From Both Sides. Deep Throat. Yumi Saeki ka, Hina Nanami

  • yuka saeki hina nanami hina nanase censoredblowjobslutDASDdasmasaki naoDASD-918DASD918dasd00918
    • 2021-09-30
    141 min

    [AARM-019]This Ex Gal Has Gotten 100 Guys Off In Her Past, Now She Brings Her Amazing Temptress Techniques To Give Full Satisfaction At Home By Opening A Sexy Masochistic Salon. Wakana Asamiya

  • wakana asamiya censoredhandjobsingle workAARMaroma kikakukadowaki shigeoaromaAARM-019AARM019aarm00019
    • 2021-10-08
    94 min

    [VENX-080]"Let My Just Put My Tits Right There For You..." A Busty Mother-in-law Comes In For Hot Bath Sex. Amu Ohara

  • amu ohara censoredcreampiebig titsVENXvenuskitano majimeincest vi nasuVENX-080VENX080venx00080
    • 2021-10-20
    30 min

    [279UTSU-516]ゆなさん

  • amateur censoredbig titsmarried womanutsuutsu-516utsu516279utsu-516
    • 2021-10-21
    127 min

    [JRZE-081]First Time Filming in Her 60s, Sawako Matsui

  • sawako matsui censoredcreampiemarried womanJRZEcenter villageshibuyajurakuJRZE-081JRZE081h-086jrze00081
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-06
    62 min

    355OPCYN-194 Misuzu 2 (Kashii Misuzu)

  • amateur censoredamateuropcynopcyn-194opcyn194355opcyn-194
    • 2021-11-09
    67 min

    200GANA-2579 In The Spear Room Of The Nampa Teacher Of 100 Battles, Bring In Sex Hidden Shooting 226 Slender Beauty Bring A Beautiful Busty Beauty To The Room! As I Made A Pass At A Chara Event In Tokyo, I Easily Accept Erotic Invitations. Voyeur How

  • amateur censoredbig titsamateurganagana-2579gana2579200gana-2579



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online