gvh




FC2ABWAPODAUKGFSDSSSSNIDASDMIDVMILKDTTCAWDCJODRBDHODVMEYDADNSANNACXVENUAMBISHKD

2020-12-11
110 min

[XRW-954]Dirty Talk Glory Hole Masturbation Noa Shiina

  • shiina noa censoredcreampiesingle workXRWreal worksreal real worksXRW-954XRW954172xrw00954
    • 2020-12-18
    204 min

    [FCH-069][Specialized For Streaming] Enjoy Absolute POV Viewing While A Beautiful Girl Tells You How Good You Make Her Feel And She Licks Yuor Nipples, And Gives You So Many Slick And Slippery Handjob Ejaculations That She's About To Pump You Dry

  • ichika matsumoto himari kinoshita himari hanazawa censoredbig titsbeautiful girlFCHprestigefetish factionFCH-069FCH069118fch00069
    • 2020-12-25
    50 min

    Pacopacomama 122520_402 Yuki Shinoda

  • yuki shinoda uncensoredcreampieblowjobpacopacomama
    • 2021-01-01
    139 min

    [PKPD-127]Sleepovers With Girl Nerds Caught On Camera - One Night Of Raw Sex With Innocent Anime-Loving Goddess Tsumugi Narita - Feel Like Her Boyfriend Tsumugi Narita

  • narita tsumugi censoredcreampiebeautiful girlPKPDfuck group and fun friends daydreamersPKPD-127PKPD127pkpd00127
    • 2021-01-15
    300 min

    [NIKM-052]Colossal Titties: J-K Cups 5 Hours

  • shiiba mikuru amemiya ibuki censoredbig titsNIKMnikumorisuginokiNIKM-052NIKM052h-1323nikm00052
    • 2021-01-20
    53 min

    FC2PPV 1652623 Iki crazy woman] Nerima G cup busty wife 25 years old [20,000 yen a day, monitor recruitment] Wife who came to the adult toy test pretending to be serious. When she shows a big cock, she immediately falls. She has convulsions acme many

  • amateur uncensoredfc2
    • 2021-01-20
    137 min

    [OVG-162]She Shifted Her Panties Down The Hole In Her Pantyhose And Shoved My Cock In! This Slut Is Luring Me To Temptation With Dirty Talk And Riding Me For Cowgirl Creampie Sex

  • mizuki sanada hinata clan censoredcreampieslutOVGglory questOVG-162OVG16213ovg00162
    • 2021-01-22
    115 min

    [PARATHD-3095]12 Japanese Married Sluts - Wives Who Love Other Men's Cocks - (2)

  • censoredmarried womanmature womanPARATHDparadise tvPARATHD-3095PARATHD3095parathd03095
    • 2021-01-26
    47 min

    C0930 ki210126 Aika Tanuma 21years old

  • amateur uncensoredc0930
    • 2021-01-29
    43 min

    [CLO-118]Beauty Parlor Slut Monami Takarada

  • takarada monami censoredbig titsblowjobCLOchobitchchovicCLO-118CLO118h-1435clo00118
    • 2021-01-29
    237 min

    [OKAX-698]Home Invasion: Married Woman Gets Ravished 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-698OKAX69884okax00698
    • 2021-02-11
    93 min

    [OKK-023]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Runa Tsukino Enjoy A Cute Lolita In A Competitive Swimsuit To Your Heart's Content! Watch Them Change In Peeping Videos, And Check Out Their Tiny Titties, Big Tits, And Shaved P

  • tsukino luna censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-023OKK0231okk00023
    • 2021-02-17
    116 min

    [pow-040]くちく☆逆バニー

  • amateur censoredbig titsamateurpowpow-040pow040pow-040
    • 2021-02-25
    117 min

    [FSDSS-173]I-Cup Tits Cumshot Support Cosplay Sara Kamiki

  • sara kamiki censoredbig titscosplayFSDSSfalenokaorufaleno starFSDSS-173FSDSS1731fsdss00173
    • 2021-03-01
    153 min

    [DOKS-537]New - Sexually Frustrated Wives Watch People Jack Off No. 4

  • censoredamateurblowjobDOKSofficeDOKS-537DOKS53736doks00537
    • 2021-03-07
    54 min

    FC2PPV 1679101 Yuko, an active cosmetologist who has an adult sex appeal ❤️ We are looking for someone who will change into naughty underwear and defeat the sexual desire monster that tempts you together.

  • amateur uncensoredfc2
    • 2021-03-11
    60 min

    [SIROR-053]Older Women For Rent ~ Her Husband Doesn't Know This Side Of Her No. 53

  • censoredcreampiebig titsSIRORdispatched.comSIROR-053SIROR053h-1492siror00053
    • 2021-03-12
    35 min

    FC2PPV 1722707 [No first shot vaginal cum shot] 140 minutes suddenly 2 packs Sober Loriko is a 20-year-old claw I tried to vaginal cum shot to that child who was an adult in the class w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-15
    41 min

    492MERC-247 Anal Sex At The Garbage Mansion 2

  • amateur censoredcreampieschoolgirlmercmerc-247merc247492merc-247
    • 2021-03-17
    240 min

    [YVG-028]Tears, Squirting, Sweat, Saliva, Love Juices, And Female Body Fluids

  • censoredsquirtingYVGglory questYVG-028YVG02813yvg00028
    • 2021-03-25
    125 min

    [JRZE-037]First Time Filming My Affair - Nanako Agawa

  • nanako agawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-037JRZE037h-086jrze00037
    • 2021-03-26
    240 min

    [OKAX-716]Sexy Older Women + Ultra Small Camera Incredible Titillating Footage ~ 40, 50, And 60 year Old Escort Version H

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-716OKAX71684okax00716
    • 2021-04-02
    119 min

    [JUL-534]永遠に終わらない、中出し輪●の日々。 鈴乃広香

  • hiroka suzuno censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-534JUL534jul00534
    • 2021-04-03
    41 min

    H4610 ori1753 Erika Inaga 23years old

  • amateur uncensoredh4610
    • 2021-04-08
    92 min

    [NUKA-045]Six Shots Of Creampie Without Pulling Out - Family Fun Close-up Intercourse - Mio Kimishima

  • kimishima mio censoredcreampiemarried womanNUKAcenter villagekotaro misatozora center villageNUKA-045NUKA045h-086nuka00045
    • 2021-04-09
    168 min

    [IPX-636]"If You Missed The Last Train, Come Stay At My Place？" I've Got A Girlfriend, But Since I Couldn't Get Home I Stayed The Night A Female Coworker's... She Didn't Wear Panties Or A Bra And I Got So Horny I Couldn'

  • iyo fujii censoredblowjobbeautiful girlIPXidea pocketkahori maedanodishIPX-636IPX636ipx00636
    • 2021-04-22
    207 min

    [NHDTB-520]居酒屋痴●4 歓迎会中にリモバイアクメする新人巨乳社員SP

  • censoredbig titsNHDTBnatural highjaken kodamaNHDTB-520NHDTB5201nhdtb00520
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    130 min

    [FLAV-267]Give Your Cock A Tune-Up: Erection Assistant Girls - Voluptuous Cock Cheerleader With Colossal Tits

  • censoredbukkakeFLAVdigital arkdigital ark digital arkFLAV-267FLAV267flav00267
    • 2021-05-08
    102 min

    [EKDV-660]While My Parents Were Away ... We Orgasmed With Deep And Rich French Kisses! My Private Tutor Is A Sadistic Bitch With Black Hair Who Gave Me A Mean Handjob And I Gave In To Her Temptation And Ejaculated, Over And Over Again Mahiro Ichiki

  • mahiro ichiki censoredschoolgirlsingle workEKDVcrystal eizoe kissEKDV-660EKDV660ekdv00660
    • 2021-06-05
    139 min

    [PKPD-147]MSGK Unauthorized Creampie Sex - Mental Minefield Crazy Young Idol Kurumi-chan (18) & Beast-Girl Ami Who Loves Hunting For Cock On Social Media (18)

  • hyakuta walnut ami kashiwagi censoredcreampieschoolgirlPKPDfuck group and fun friends daydreamersPKPD-147PKPD147pkpd00147
    • 2021-06-09
    66 min

    SIRO-4545 [First shot] [Sex beginner] A shy naive girl overflows with love juice and feels it. With a leaking voice, "Is it dead ..？" AV application on the net → AV experience shooting 1558

  • amateur censoredamateursirosiro-4545siro4545siro-4545
    • 2021-06-12
    102 min

    [VENX-046]I Can't Survive Without My Stepson Anymore... 50 Intense Orgasms - Extreme Ecstasy Erotic Creampie Trance Mio Kimijima

  • kimishima mio censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-046VENX046venx00046
    • 2021-06-16
    27 min

    FC2PPV 1871208 Up to 23 1280 [Leaked] A junior at a fair-skinned workplace. She is suspicious of the camera but she is swept away by her atmosphere and vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-07-01
    120 min

    [DKWT-014]Picking Up Someone Else's Wife I Just Wanted A Part Time Job Washing Dicks...But Got So Horny For Big Hard Dicks That I Even Had Raw Sex 1

  • censoredcreampieamateurDKWToffice k swakadzumaDKWT-014DKWT01436dkwt00014
    • 2021-07-02
    480 min

    [DVDMS-687]MM Number And Magic Mirror Bus 2 Discs 8 Hours Best 50 Shy Amateur Girls Have Their First Intercrural Sex Experience! They Can't Resist A Hard Cock Rubbing Their Clit And It Slips In Raw! Special Collector's Edition!!

  • censoredamateurDVDMSdeepsthe magic mirror mm mm flightsDVDMS-687DVDMS687dvdms00687
    • 2021-07-29
    87 min

    435MFC-128 [Advocacy Body That You Want To Protect] Excited By The Fair-Skinned Slender Saffle And The First Gonzo! All-You-Can-Eat With Vaginal Cum Shot Sex And Cosplay Sex To Commemorate The Virginity Of Gonzo! [Shiroto Gonzo ＃ Rei ＃ 23 Years Old ＃

  • amateur censoredcreampieamateurmfcmfc-128mfc128435mfc-128
    • 2021-08-13
    163 min

    [MVSD-476]You Want To Become Famous Right？ My Girlfriend Who Dreams About Becoming A Model Becomes A Meat Stool For The Scumbag Who Brainwashed Her. Kokona Asakura

  • asakura here censoredcreampiebig titsMVSDm s video groupmaeda bungoums video groupMVSD-476MVSD476mvsd00476
    • 2021-08-17
    35 min

    361SEKAO-159 Siwon From South Korea

  • amateur censoredbig titsamateursekaosekao-159sekao159361sekao-159
    • 2021-08-18
    480 min

    [RVG-139]Kana Morisawa BEST vol. 1

  • kana morisawa kanako iioka censoredslutRVGglory questRVG-139RVG13913rvg00139
    • 2021-08-20
    238 min

    [CJOB-094]I"ll Tease Your Nipples Until You Blow Your Load Endlessly Best 3

  • hasumi claire shinoda yu censoredsluthandjobCJOBbichijo hebun bestCJOB-094CJOB094cjob00094
    • 2021-09-01
    120 min

    [NACR-456]My Neighbor Is A Cheating Slut Toka Rinne

  • roaring sound censoredcreampiebig titsNACRplanet plussakura ninshichi ku ryuuNACR-456NACR456h-237nacr00456
    • 2021-09-03
    300 min

    [DVDMS-705]A Devilish Slut Who Will Let You Give Her An Anal Licking Enjoy This Bitch With A Pretty Ass As She Cums Like Crazy In Anal Lust-Baring Sex And Anal Cunnilingus So Musty And Busty And Smelling And Tasting Like Heaven, It Will Set Her Assho

  • ichika matsumoto aoi kururugi censoredcreampieslutDVDMSdeepsmotofuji peroflavorsDVDMS-705DVDMS705dvdms00705
    • 2021-09-17
    84 min

    [VEC-495]The Mom"s Friend Asaka Tomita

  • asaka tomita censoredcreampiemature womanVECvenuskaniemegami venusVEC-495VEC495vec00495
    • 2021-09-24
    240 min

    [REXD-383]Don"t Talk To Me! A Female Doctor Berates A Janitor But She Didn"t Realize That He Was Licking Her Entire Body ...

  • censoredcreampieREXDredgroupREXD-383REXD383rexd00383
    • 2021-10-06
    120 min

    HHL-003 M.K (Mai Kagari)

  • amateur censoredamateurcosplayhhlhhl-003hhl003hhl-003



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online