high 091




FC2AUKGONEZSSNISDABMIDEHDKAKSBJMILKCAWDMARADTTFSDSSWAAAMIDVVENUADNAPODAUKSBBANJUL

2020-11-26
115 min

[SPRD-1347]Dear Stepmom, I, I Like You Better Than My Wife... Mirei Fujisaki

  • misaki fujisaki censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1347SPRD134718sprd01347
    • 2020-11-28
    64 min

    HEYZO 2404 Hitotsumami -Sex Toy Is Not Enough!- – Sakuya Nishizono

  • amateur uncensoredcreampieheyzo
    • 2020-12-04
    72 min

    FC2PPV 1593693 [No first shot] E-cup music college student Sana-chan 20 years old While nervous about the first Gonzo in my life, at the end, [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-05
    119 min

    [JUL-393]Bareback Adultery With The Shy Married Woman At My Workplace. Kana Mito

  • kana mito censoredcreampiemature womanJULmadonnayosukeJUL-393JUL393jul00393
    • 2020-12-10
    56 min

    [orex-194]えりなちゃん

  • amateur censoredcreampieschoolgirlorexorex-194orex194orex-194
    • 2021-01-03
    50 min

    1Pondo 010321_001 Braless Neighbor In The Morning: Emi Aoi

  • amateur uncensored1pondo
    • 2021-01-12
    251 min

    [GDAN-001]DANCE FUCK CARNIVAL: The Most Amazing Dance! BEST 251 Min. Dancers, 8 People

  • censoredcreampieGDANmercurydance carnivalGDAN-001GDAN001h-1133gdan00001
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    104 min

    [hoi-155]Iちゃん(21)

  • amateur censoredbig titsamateurhoihoi-155hoi155hoi-155
    • 2021-01-19
    69 min

    300NTK-504 One-off butt beauty and muscle training & aphrodisiac! !! Reproductive impulse MAX estrus parameter shake off impulsive cheating SEX! !! Pant and tremble with raw chin rush, Keiren big cum! !! A beautiful woman’s instinct SEX feas

  • amateur censoredcreampieamateurntkntk-504ntk504300ntk-504
    • 2021-02-15
    480 min

    [NPS-408]Female Director Haruna Amateur Lesbian Seduction: 60 Girls, 8 Hours Best Collection 16

  • abe mikako kato camellia censoredamateurlesbianNPSpetersnampaNPS-408NPS408h-021nps00408
    • 2021-03-06
    60 min

    200GANA-2442 Seriously Nampa, first shot. 1606 Call out to a female college student who lacks sleep, Why don’t you try a good sleep pillow？ ⇒ Hotel IN! The pillow becomes an actor’s arm pillow before you know it! The humble girl is complete

  • amateur censoredamateurganagana-2442gana2442200gana-2442
    • 2021-03-06
    158 min

    [BF-627]I Was Jealous Of My Classmate, Who Was Dating A College S*****t ... So While My Classmate Was At Home, I Spent 2 Days And A Night Furiously Fucking Her Boyfriend. Asuka Momose

  • momose asuka yuuri censoreduniformschoolgirlBFbefreeroku yonBF-627BF627bf00627
    • 2021-03-10
    30 min

    FC2PPV 1720679 [Individual shooting] [4K high image quality] Prefectural Ordinary Course FJK A curious black-haired beautiful girl who doesn’t feel like using her pussy! Natural pink pussy with beautiful nipples Full view wIO only slippery / Suj

  • amateur uncensoredfc2
    • 2021-03-20
    89 min

    [KIR-030]I Owe My Artist Friend Money And In Order To Pay My Debt My Wife Had To Become A Nude Model For Him Sara Kagami

  • kagami sara censoredcreampieblowjobKIRstar paradisekirei star paradiseKIR-030KIR030h-254kir00030
    • 2021-03-25
    45 min

    FC2PPV 1741123 Celica and amateur’s 5P Celica’s cuteness and the tension of shooting make it impossible to shoot … Then the eagle is vaginal cum shot at the end

  • amateur uncensoredfc2
    • 2021-03-30
    86 min

    FC2PPV 1747334 980 yen! [During the first life] Just before the Gei 〇 office contract! !! I took off the rubber while shooting by myself and got vaginal cum shot from raw etch! The face is bright red and the vulgar Ahegao is exposed and dies! !! 20 y

  • amateur uncensoredfc2
    • 2021-04-03
    200 min

    [YMDD-225]Street Corner Snaps #TokyoMaskBeauty ~ Checking Whether That Beauty In A Mask Is Actually Beautiful ~

  • censoredamateurbeautiful girlYMDDmomotaro eizohimu lockwakamomoYMDD-225YMDD225ymdd00225
    • 2021-04-06
    60 min

    499NDH-012 A metamorphosis beauty OL who carries My electric massage machine! While selling toys to children at a department store, close contact sexual intercourse with a new member of society who wants to comfort frustration with sex toys! !! [Is i

  • amateur censoredamateurndhndh-012ndh012499ndh-012
    • 2021-04-16
    115 min

    [PARATHD-3147]I Will Do Anything To Fuck My Mom's Friend With A Bangin Booty (6)

  • censoredmarried womanamateurPARATHDparadise tvPARATHD-3147PARATHD3147parathd03147
    • 2021-04-17
    121 min

    [JUL-546]Underwear Model Cuckholding Shocking Adultery Footage Of A Wife Getting Seduced By The Cameraman Asahi Mizuno

  • mizuno chaoyang censoredcreampiebig titsJULmadonnacaptain orionJUL-546JUL546jul00546
    • 2021-05-05
    120 min

    [GVH-231]Stepmom's Real Sex Ed Ryo Hitomi

  • ryo hitomi censoredcreampiemature womanGVHglory questkisakura kabinGVH-231GVH23113gvh00231
    • 2021-05-07
    120 min

    [MIDE-926]The Office Playboy Walked My Busty Girlfriend To Her Car And Now She's Not At Work Today... Nozomi Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyzsuisei akaimoodyz divaMIDE-926MIDE926mide00926
    • 2021-05-20
    184 min

    [SW-778]A Sweet And Sadistic Innocent Maid "I Love My Perverted Master's Cock" What A Piece Of Shit You Are! You Perverted Comic Lover! Marina Is A Sadistic Maid Who Is Spewing Vitriol At Me, And Kicking Me And Showing Off Her Panties And

  • marina saito censoredsingle workSWswitchlight fujimaswitch switchSW-778SW7781sw00778
    • 2021-05-21
    119 min

    [JUL-589]Strange People Flock To Me, A Part-time Worker. A Suburban Love Hotel Turns Into A Hangout For Perverts. Rin Ogawa

  • rin okae censoredbig titsmature womanJULmadonnahiroyuki kimuraJUL-589JUL589jul00589
    • 2021-06-04
    102 min

    [ADN-323]I Fucked My Wife Who Fell In Love With Her Affair Partner And Now Hates Me Hikari Ninomiya

  • hikari ninomiya censoredsingle workdramaADNattackersbungo maedaotona no dramaADN-323ADN323adn00323
    • 2021-06-11
    170 min

    [JUFE-295]A Fresh Face This F-Cup Titty Babe May Not Look It, But She's A Sexual Monster! This Former Competitive Swimmer Was Caught In A String Of Orgy Sex And Was Expelled But She Wanted Even More Excitement So She's Making Her Adult Video

  • kisaki anna censoredbig titssingle workJUFEfitchJUFE-295JUFE295jufe00295
    • 2021-06-17
    129 min

    [TOEN-043]Whenever Her Husband Takes A Short Break, Her Big Brother-In-Law Hits Her With Over 10 Creampie Cum Shots, Every Single Day ... Mio Saionji

  • mio saizonoji censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-043TOEN043h-086toen00043
    • 2021-06-19
    117 min

    [HMN-009]For The Sake Of Her Impotent This Married Woman She Went To This Rundown Dump And Enjoyed Deep And Rich Impregnation Sex With A Single Man Who Had Spent The Past 30 Days Storing His Semen Hikari Kisaki

  • ayu sakurai censoredsingle workHMNsaimin kenkyuujosaimin mansionHMN-009HMN009h-443hmn00009
    • 2021-07-19
    53 min

    328HMDN-384 [Personal Shooting] A Major Cosmetics Manufacturer Sales Harrun The Lascivious Nature Of A Neat And Clean Office Lady! Ejaculation Management While Spoiling With F Cup Beauty Big Tits Shaved Body That Captivates A Man Boobs Bouncing With

  • amateur censoredcreampiebig titshmdnhmdn-384hmdn384328hmdn-384
    • 2021-07-23
    58 min

    [asgm-012]さり

  • amateur censoredcreampieuniformasgmasgm-012asgm012asgm-012
    • 2021-07-30
    101 min

    [YST-250]Mr Honma is my Master Yuri Honma

  • really censoredcreampiebig titsYSTkoyachoYST-250YST250540yst00250
    • 2021-08-19
    241 min

    [AKDL-134]I Will Play With Your Nipples-Full Nipple Play! SUPER BEST

  • yui hatano yahashi bridge censoredbig titsbeautiful girlAKDLaquinorifsetaknrAKDL-134AKDL1341akdl00134
    • 2021-08-30
    41 min

    292MY-474 Misa Koide 2

  • amateur censoredcreampiebig titsmymy-474my474292my-474
    • 2021-09-01
    123 min

    [GVH-283]Anal Collapse Rui Hizuki

  • rui hizuki censoredanalsingle workGVHglory questtorindoru tanakaGVH-283GVH28313gvh00283
    • 2021-09-04
    57 min

    FC2PPV 2147849 [Tsuyasu Delivery Female College Student] Healing Angel (21 Years Old) Supporters 20,000 Class! Big Breasts River Shooting Mane And Gonzo Cum Shot At The Hotel After Delivery Personal Shooting [Caution For Handling Strict Prohibition]

  • amateur uncensoredfc2
    • 2021-09-09
    107 min

    [MESU-088]Mature Woman Working As Call Girl Gets A House Call. It"s The Boss From Work!？ Lower Level Employee Enjoys A Sudden Role Reversal For Hot Creampie Sex. Yuka Mizuno

  • yuka mizuno censoredcreampiemature womanMESUcenter villagesouthern earthred snowMESU-088MESU088h-086mesu00088
    • 2021-09-11
    114 min

    [BABM-003]The Doting Step-Mom Ena Makes Me Feel Loved And Takes Care Of Me And When I Cry She Spoils Me With Sex Ena Koume

  • ena koume censoredcreampiebig titsBABMkaguya hime pt mousozokuyumesaki ichiroubabubabu no jitsuBABM-003BABM003babm00003
    • 2021-09-18
    62 min

    519MAZOF-016 [Jueju] Receptionist 27 Years Old [Beautiful Slut] Cum Shot In 1 Hour Of Break "There Is No Company Anymore" Uterus Hihi Pleasure Acme Convulsions I Can Not Stop, So I Will Attack The Big Cock Piston Steadily

  • amateur censoredcreampieamateurmazofmazof-016mazof016519mazof-016
    • 2021-09-23
    118 min

    [HBAD-596]After Coming Back To Live At Home And Take Care Of Family, She Ends Up Having To Slurp And Deepthroat A Dick With Teary Eyes During Rough Sex. Hikaru Konishi

  • hikaru konishi censoredblowjobsingle workHBADhibinoumanami jirobabeHBAD-596HBAD5961hbad00596
    • 2021-10-01
    151 min

    [CAWD-293]"Never Should Have Made You Celibate!" Throw Out All The Rules And Script! All The Fucking You Could Ever Want. Hana Shirato And Meru Ito. Sexy Plan To Turn Them Into Horny Sluts.

  • ito meru white peach censoredcreampieslutCAWDkawaiiCAWD-293CAWD293cawd00293
    • 2021-10-19
    77 min

    230OREC-915 Nana (Hayami Nana)

  • amateur censoredcreampieamateurorecorec-915orec915230orec-915
    • 2021-10-22
    56 min

    552PIEN-001 Non (Rion Izumi)

  • amateur censoredcreampieamateurpienpien-001pien001552pien-001
    • 2021-11-05
    119 min

    [HZGD-203]The Cherry Boy Next Door Finally Has A Girlfriend So As A Kind Married Woman I Let Him Practice Sex and Creampies. Ichika Matsumoto

  • ichika matsumoto censoredcreampiesingle workHZGDhitodzuma hanazono gekijouoosaki hirokoujiHZGD-203HZGD203h-1100hzgd00203
    • 2021-11-05
    31 min

    FC2PPV 2404260 Appearance! !! Limited Number! [Uncensored] Cum Shot & Vaginal Cum Shot To A Nasty Busty Beauty Wearing A Sweet Perfume Scent And A Lewd Scent! !!

  • amateur uncensoredfc2
    • 2021-11-19
    61 min

    FC2PPV 2447319 Active J ◯ Pocha × 2 Kawa Who Is Nervous ❤ Massive Love Juice & Squirting From Pure Innocent Minimum Vagina ❤ Armpit Job On Marshmallow Body, Transformation Play Of Oral Ejaculation ❤

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online