high vision image jav javcensored beautiful girl




FC2HNDAUKSFSDSSMIDEADNSPRDRBDATIDJUFESQTEMEYDMILKMIAAPREDSANMARAKBIWAAAHODVIPX

2020-10-03
169 min

[JUL-336]24 Hours A Day, This Stepmom Is Luring Her Son-In-Law To Temptation Because She Wants His Big Cock So Badly, She Just Can't Help Herself Ayumi Miura

  • ayumi miura censoredbig titsmature womanJULmadonnakogoro kindaichiJUL-336JUL336jul00336
    • 2020-10-09
    143 min

    [BAZX-251]Complete Love Declaration! Full POV Uniform Refresh vol. 001

  • ichika matsumoto himari kinoshita censoredcreampieuniformBAZXbazookatodoBAZX-251BAZX251h-1496bazx00251
    • 2020-10-18
    300 min

    [LZBS-064]Boobquake! Wild Hip-Humping Cowgirl Best Selections 5 Hours - See Sensitive Pussies Twitching Through Limitless Orgasms!

  • hasumi claire yano tsubasa censoredbig titslesbianLZBSlesrebest lesbian playLZBS-064LZBS064lzbs00064
    • 2020-10-23
    241 min

    [SALO-027]5 Queens' Breaking In Room - 4 Hours

  • akari shinmura misuzu kawana censoredbdsmSALOkm producesalomeSALO-027SALO02784salo00027
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-27
    243 min

    [GAID-008]Ravaged By Beasts... 243 Minutes Non-Stop Action! Wave After Wave Of Footage Shot By Modern Masters Of Rough Sex! 4 Flicks In A Row!

  • censoredbig titsamateurGAIDfirst staraida first starGAID-008GAID008h-491gaid00008
    • 2020-11-05
    72 min

    Pacopacomama 110520_380 Miu Takeda

  • miu takeda uncensoredcreampieblowjobpacopacomama
    • 2020-11-19
    151 min

    [TIKB-097]This Delicate Girl With Small Breasts Has A Full Body Erogenous Zone. She Transforms Into A Masochist.

  • censoredcreampieschoolgirlTIKBtikitiki.comerTIKB-097TIKB097tikb00097
    • 2020-11-19
    68 min

    SIRO-4323 [First shot] [Superb service of Miss Esthetics] [Unstoppable climax] A must-see for the daring death of a beautiful woman who was fascinated by her calm appearance. She keeps panting for pleasure while becoming fluffy .. AV application on t

  • amateur censoredamateursirosiro-4323siro4323siro-4323
    • 2020-11-28
    191 min

    [MIAA-353]Lingam "Testicles" Sensual Massage Slow Reverse Handjob Gentle Orgasm Giving Rejuvenation Massage Parlor

  • censoredcreampieblowjobMIAAmoodyzsuisei akaieveryone s porn starMIAA-353MIAA353miaa00353
    • 2020-12-11
    106 min

    [XRW-950]She's Not Allowed To Fuck Her Customers, But What If You Asked Her Nicely？

  • censoredamateurblowjobXRWreal worksreal real worksXRW-950XRW950172xrw00950
    • 2020-12-21
    59 min

    328HMDN-322 [College student x finest god milk celebrity wife] Personal shooting 32 years old God BODY beautiful wife whose husband is sexually weak and frustrated and violently fucked vagina and breast with big cock [Amateur / beautiful wife]

  • amateur censoredcreampiebig titshmdnhmdn-322hmdn322328hmdn-322
    • 2020-12-27
    136 min

    [GONE-025]Ayaka Muto's WET Crazy FUCK

  • ayaka muto censoredbig titssingle workGONEmercuryan erotic tanned elder sisterGONE-025GONE025h-1133gone00025
    • 2021-01-09
    57 min

    [fc2-ppv 1637698]【数量限定】瀧◯梨絵 ① （長尺ver）

  • amateur uncensoredfc2
    • 2021-01-09
    120 min

    [MIDE-873]Her Lust Is Off The Charts! She Hasn't Gotten Laid In 30 Days And Now She's Desperate To Get Fucked - Raging Horny Slut At A Hot Spring Ibuki Aoi

  • aoi ibuki censoredbig titssingle workMIDEmoodyzmichiru arashiyamamoodyz divaMIDE-873MIDE873mide00873
    • 2021-01-09
    142 min

    [EBOD-791]She Can Never Turn Down An Invitation!？ This Natural Airhead Otaku Girl Is Unwittingly Luring Men To Temptation With Her Titties This H-Cup Otaku Nerd Is Self-Conscious But Very Kind And Gentle, And When She Gets Loaded With Cock, She Turns

  • first love censoredbig titssingle workEBODe bodymametaro mamezawaEBOD-791EBOD791ebod00791
    • 2021-01-16
    118 min

    [SSNI-968]I Always Hated My Girlfriend's Little Sister Because She Always Treated Me Without Any Respect, But We Were Stuck In The Same Room At A Hot Spring Resort Inn, So We Fucked Each Other So Hard I Thought I Was Going To Get Sick Mako Iga

  • iga mako censoredsingle workdramaSSNIs1 no 1 styletiger kosakaiSSNI-968SSNI968ssni00968
    • 2021-01-17
    31 min

    FC2PPV 1648619 [New] [Until January 24, 1900pt → 1500pt] Gonzo with a 21-year-old erotic nursery teacher! !! The chestnut and the inside are rolled up with an erogenous zone!

  • amateur uncensoredfc2
    • 2021-01-28
    112 min

    [SPRD-1368]Ever Since I Slept Next To My Stepmom ... Kozue Tokita

  • kozue tokita censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1368SPRD136818sprd01368
    • 2021-02-02
    62 min

    [KBTV-062]Theory: If I Sign A Contract With An Insurance Saleswoman Who Looks She Isn't Getting Many Clients, There's A Good Chance She'll Let Me Fuck Her

  • censoredcreampiebig titsKBTVmessy tvKBTV-062KBTV062h-1514kbtv00062
    • 2021-02-03

    FC2PPV 1669719 Limited [Individual] A wife who is called to a part-time inn and vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-02-05
    52 min

    FC2PPV 1639386 [Limited quantity] Mosaic collapse version ❤️ Fallen beauty witch Hostess Anna ❤️ Public walk with a remote rotor

  • amateur uncensoredfc2
    • 2021-03-04
    88 min

    [REBD-537]Kana: A Girlfriend For Only Me - Kana Kusakabe

  • kana kusakabe censoredsingle workREBDrebeccahaka kureREBD-537REBD537h-346rebd00537
    • 2021-03-04
    22 min

    HEYZO 2472 Moe’s Orgasms with Toys – Moe Nashiki

  • moe nashiki uncensoredhandjobheyzo
    • 2021-03-06
    73 min

    FC2PPV 1714942 ☆ 1000pt OFF until March 14th for a limited time! !! !! [No / piece] Sweet angel Slightly Pocha Mika whipped cream with fresh cream ♪ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-03-18
    147 min

    [SSIS-014]The Reason A Married Woman Turned To Prostitution For Her Husband ~ I Let Other Men Fuck Me Because Of My Love For You... HZZ

  • yumeno aika censoredbig titssingle workSSISs1 no 1 styleamazing meatSSIS-014SSIS014ssis00014
    • 2021-03-25
    55 min

    230ORETD-858 Yukine

  • amateur censoredcreampieuniformoretdoretd-858oretd858230oretd-858
    • 2021-03-26
    110 min

    483SGK-019 [18-year-old young supernova] [Super big pie G soft milk] [Great big ass] [Continuous pursuit super creampie] [No runaway convulsions Ikipa] Erotic erotic too erotic! 18-year-old Pichi Pichi super new star gal invades! !! !! If the big bre

  • rgal censoredcreampiebig titssgksgk-019sgk019483sgk-019
    • 2021-03-27
    55 min

    HEYZO 2489 Exploring Every Corner Of A Girl With Big Beautiful Bazookas! – Rena Hiragi

  • rena hiragi uncensoredcreampiehandjobheyzo
    • 2021-03-29
    61 min

    SIRO-4474 [First shot] [Beautiful legs of temptation] [Premature ejaculation female college student] The sexual desire of a female college student who was nervous explodes with SEX after a long absence. If you shake your hips with her wide open and e

  • amateur censoredamateursirosiro-4474siro4474siro-4474
    • 2021-04-08
    92 min

    [NUKA-045]Six Shots Of Creampie Without Pulling Out - Family Fun Close-up Intercourse - Mio Kimishima

  • kimishima mio censoredcreampiemarried womanNUKAcenter villagekotaro misatozora center villageNUKA-045NUKA045h-086nuka00045
    • 2021-04-10
    108 min

    [OIGS-038]Married Rope Slut Succumbs To The Pleasure Of S&M And The Ecstasy Of Owned Flesh Chitose Yuki

  • chitose in the evening censoredbig titsbdsmOIGSavs collector susubashisuiavscollector sOIGS-038OIGS038oigs00038
    • 2021-04-11
    62 min

    FC2PPV 1765021 First shot ♥ ️ Blonde short fair-skinned beauty big breasts with one-time melody seeding SEX! !! 【selfie】

  • amateur uncensoredfc2
    • 2021-05-02
    211 min

    [YMDD-229]Home Delivery Gal! Battle To Compare Your SK**ls And See How Much You Can Cum! Death Match: How Many Shots Can You Get Off？ vol. 03

  • konno saki shiiki walnut censoredblowjobhandjobYMDDmomotaro eizohimu lockwakamomoYMDD-229YMDD229ymdd00229
    • 2021-06-11
    124 min

    [MIDE-942]The Mean President's Secretary Tsubomi Makes Me Give Her Creampies By Talking Dirty To Me And Showing Me Her Panties

  • bud censoredcreampieslutMIDEmoodyzham the mcmoodyz divaMIDE-942MIDE942mide00942
    • 2021-07-02
    37 min

    480FRIN-039 [Otsuka] Mature Woman Deriheru Hidden Shooting-A Young Man Will Get Creampie Raw Production OK [42 Years Old G Cup]

  • amateur censoredcreampiebig titsfrinfrin-039frin039480frin-039
    • 2021-07-09
    54 min

    FC2PPV 1913271 [No / piece] Small devil maid advent! I’ll pour semen into my mouth to thank you for making me feel good with a smile ♡ * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-07-10
    205 min

    [BAZX-297]S******g One's Way Up the Ladder Through Creampie Raw Footage And Ovulation Day with Your Most Beloved and Favorite Idol vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-297BAZX297bazx00297
    • 2021-07-17
    71 min

    355OPCYN-174 Ichika Nagano Ichika

  • amateur censoredamateurbeautiful girlopcynopcyn-174opcyn174355opcyn-174
    • 2021-07-30
    120 min

    [JUL-672]My Husband Cannot Satisfy Me...The Married Woman Who Fell For The Well-Endowed Shop Manager At Her Part-Time Job. Nao Jinguji.

  • jinguji temple nao censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-672JUL672jul00672
    • 2021-08-03
    53 min

    SIRO-4595 [First Shot] [Big Breasts Fucking] [Dirty Ass Back] A Big Breasted Waitress Who Has An Adult Sex Appeal While Being 20 Years Old. Welcome A Meat Stick For The First Time In About 2 Years And Make Big Tits And Whip Buttocks Rippling .. Av Ap

  • amateur censoredbig titsamateursirosiro-4595siro4595siro-4595
    • 2021-08-07
    228 min

    [XRLE-013]Creampies Deep Down The Throat Of A Beautiful Girl: Breaking Her In For Deep Throats. Rena Aoi.

  • blue censoredbeautiful girldeepthroatXRLEk m produceani nakamurareal real worksXRLE-013XRLE013xrle00013
    • 2021-08-07
    136 min

    [CEAD-354]Girl In Glasses With Colossal Tits Has Wild Orgasmic SEX! Pounded From Above And Below, Her Big Tit Bouncing! This H-Cup Never Takes Her Glasses Off The Whole Time. Miyabi Midorikawa

  • midorikawa miyabi censoredbig titsmature womanCEADserebu no tomoCEAD-354CEAD354cead00354
    • 2021-09-10
    124 min

    [JUL-705]After The Graduation Ceremony ... Your Stepmom Is Giving You A Gift To Celebrate Your Entry Into Adulthood ... A Madonna Label Exclusive Beautiful Mature Woman Actress Is Celebrating Your Launch Into The Real World With Her Alluring Eroticis

  • hojo asahi censoredcreampiemature womanJULmadonnahimu lockJUL-705JUL705jul00705
    • 2021-10-15
    300 min

    [DVDMS-724]Ready For Their Debut! Magic Mirror Service Series. Office Ladies With Curvy Asses In Professional Suits Come To Work At This Top Company. Compilation Vol. 3. Their Big Soft Asses Are Squeezed Into Tight Suit Pants. These Shy, But Wet Elit

  • censoredamateurDVDMSdeepsfunky haseithe magic mirror mm mm flightsDVDMS-724DVDMS724dvdms00724
    • 2021-10-17
    59 min

    200GANA-2580 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Secret Shooting 222 Re-Drink On The Way Home After Drinking! Beautiful Big Tits & Nice Ass Unfussy Girls Brought Home! Outstanding Proportions That Are Cramped Even Th

  • amateur censoredbig titsamateurganagana-2580gana2580200gana-2580



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online