high vision javcensored planning nampa jav




FC2AUKSAMBISHKDNNPJCESDWAAAHMNMILKFSDSSAVSACHRVSSNICJODAUKGHNDPREDONEZPPPDMEYDABW

2020-10-10
149 min

[IPX-552]"You've Got To Be K*dding! This Can't Be Happening..." The Tables Have Been Turned! I Ordered A Delivery Health Call Girl Who Would Instantly Suck My Dick, And They Sent Me My Lady Boss, Who Is Always Bullying Me At Work. She

  • amami tsubasa censoredcreampiesingle workIPXidea pocketkyoseidishIPX-552IPX552ipx00552
    • 2020-10-24
    44 min

    FC2PPV 1545858 [Personal shooting] A married woman who works at a local government office is back dirt! I can’t control my aching body and I’m captivated by other sticks! Unstoppable lust vaginal cum shot [appearance]

  • amateur uncensoredfc2
    • 2020-11-10
    121 min

    [KTRA-254]A Step-brother's Continuous Cumming! Intercourse With His Short Haired Step-sister - Mashiro Kisaragi

  • kisaragi mashiro censoredschoolgirlsisterKTRAk tribeKTRA-254KTRA254h-094ktra00254
    • 2020-11-11

    FC2PPV 1566634 Limited number [None] Tall bike girls continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2020-11-20
    71 min

    [sqb-076]はとり

  • amateur censoredcreampieamateursqbsqb-076sqb076sqb-076
    • 2020-11-22
    120 min

    [NNPJ-414]Hidden Part Time Job Verification Document, Popular In Takadanobaba! Picking Up A Weird Big Breasted Girl, Honoka-san (Pseudonym). I Succeeded In Taking A Voyeur Video Of The Hidden Operations Performed By This Beautiful H-cup Female Basket

  • censoredbig titsNNPJnanpa japanNNPJ-414NNPJ414nnpj00414
    • 2020-11-24
    127 min

    [KMHRS-033]10-Shot Bukkake, Cum Swallowing, And Finally Her First Raw Creampie - Natural Airhead Kanon

  • natural kanon censoredcreampieamateurKMHRSsod createtiger kosakaikimihoreKMHRS-033KMHRS0331kmhrs00033
    • 2020-11-28
    80 min

    [SD-009]Porn Star Feast -HYPER HARD PORN GOURMET REPORT- Miku Abeno

  • censoredcreampieamateurSDplumbaron reikokuSD-009SD009h-113sd00009
    • 2020-11-28
    172 min

    [CLUB-621]We Seduced Only Big Tits Sexy Cosplayer Babes With Estimated Titty Sizes Of G-Cup Or Bigger And Brought Them Home For Some Hidden Camera Fun. When We Teased Them By Flashing Our Rock Hard Cocks At Them, They Got Hot And Horny And Gave Us Al

  • censoredbig titscosplayCLUBhentai shinshi clubCLUB-621CLUB621club00621
    • 2020-12-08
    73 min

    261ARA-460 [Super Eromuchi BODY] 21 years old [Working metamorphosis woman] Ema-chan is here! The reason for her application to work for a real estate company and appear on AV while going around is “I can’t stand it … ♪” We meet i

  • amateur censoredbig titsamateuraraara-460ara460261ara-460
    • 2020-12-10
    180 min

    [SW-742]I Took A Bath With My Busty Adult Stepsisters! They Started Teasing Me And I Got Hard, So When I Got Them Alone I Nailed Each Of Them For Thrice The Pleasure!

  • censoredbig titsSWswitchyocchanswitch switchSW-742SW7421sw00742
    • 2020-12-17
    115 min

    [BLK-480]Hot Gal In Uniform Has Sweaty, Greasy Sex With An Older Guy (Sugar Daddy) Who Loves To Kiss Her Himari Kinoshita

  • himari kinoshita himari hanazawa censoreduniformschoolgirlBLKkira kirakira kira black galBLK-480BLK480blk00480
    • 2020-12-18
    50 min

    FC2PPV 1590955 [Personal shooting] Appearance / Yukari 37 years old / A large amount of Tokuno sperm has been vaginal cum shot to a married woman who is aggressive in sex! !!

  • amateur uncensoredfc2
    • 2020-12-20
    162 min

    [HND-920]She'll Bowl You Over With These Tricks - Crafty, Cheeky, Sexy Slut's Creampie Porn Debut! Mariko Morishita

  • mariko morishita censoredcreampieslutHNDhon nakamametaro mamezawaHND-920HND920hnd00920
    • 2020-12-27
    125 min

    [KNAM-030]All Raw STYLE @ Mona # Bratty Young Slut # Her Panties Are Soaked # Her First Compensated Date # Powerful Pussy # Completely Raw Fuck # Buckets Of Cum Mona Amemiya

  • amemiya mona censoredcreampieblowjobKNAMfirst star100 raw styleKNAM-030KNAM030h-491knam00030
    • 2020-12-29
    59 min

    Pacopacomama 122920_406 Rinka Mizuhara

  • rinka mizuhara uncensoredcreampieblowjobpacopacomama
    • 2021-01-01
    239 min

    [DOCP-268]A Guy With An Amazing Cock Deceived My Wife By Telling Her OF A Plan For A Magazine Called "Memorial Nude Photos Of Lovely Wives," And Fucked Her At A Fake Nude Photo Session. What Was My Wife's Expression In The Super Close-Up

  • kiyoshi maihara aisu minon censoredcreampieDOCPprestigedoc premiumDOCP-268DOCP268118docp00268
    • 2021-01-15
    51 min

    444KING-026 Yume-san (26)

  • amateur censoredcreampiebig titskingking-026king026444king-026
    • 2021-01-16
    65 min

    FC2PPV 1647677 * Limited time 2980⇒1400pt! ★ Intense hot cum shot 3P orgy with devilish pleasure ♥ Miya-chan & Yukino-chan ② ☆ On the verge of exploding to a perverted blame ♥ Thick double blowjob with patience juice ♥ Reasonable raw vaginal cum

  • amateur uncensoredfc2
    • 2021-01-25
    17 min

    FC2PPV 1659037 Until 28th 980pt → 580pt [Personal shooting] Thick fucking soggy blowjob mouth launch from midday with a slender young wife

  • amateur uncensoredfc2
    • 2021-01-28
    240 min

    [GODR-1004]Picking Up Hot Wives For Real Creampie Sex - Wealthy Married Sluts Made To Cum And Pumped Full Of Seed 4 Hours, 12 Girls

  • censoredcreampiemarried womanGODRvipgodGODR-1004GODR100478godr01004
    • 2021-02-05
    271 min

    [DNW-109]Dear Beautiful Clerk. 01

  • censoredcreampiebig titsDNWprestigedocument nowDNW-109DNW109118dnw00109
    • 2021-02-06
    42 min

    FC2PPV 1675277 [I want to protect] deru deru TxxN [This smile]

  • amateur uncensoredfc2
    • 2021-02-11
    486 min

    [MEKO-205]A Highlights Video Of Married Highly Paid Nude Art Models Taking Dicks And Having Deep Hard Sex - 20 Girls, 8 Hours, 2 Discs

  • censoredcreampiemature womanMEKOmature woman laboMEKO-205MEKO205h-1160meko00205
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    39 min

    417SRYA-006 I found a rainy day flasher J ●! !! When I witnessed the outdoor masturbation of Gal J ●, I couldn’t stand it and it was convex! Gal J ● Slimy Ma ● Ko uncle Ji ● Po was raw ww

  • amateur censoredcreampieschoolgirlsryasrya-006srya006417srya-006
    • 2021-02-13
    130 min

    [CESD-974]Girls In Glasses Are Sexy! 3 Impactful Fucking Scenes!! Himari Kinoshita

  • himari kinoshita himari hanazawa censoredblowjobmature womanCESDceleb no tomoCESD-974CESD974cesd00974
    • 2021-02-20
    59 min

    Pacopacomama 022021_437 Wives Drink Cum 117 Chisato Nishiyama

  • amateur uncensoredpacopacomama
    • 2021-02-28
    61 min

    SIRO-4365 [First shot] [Pure and neat girl] [Pure white soft skin] A neat and clean JD with outstanding transparency. An innocent girlfriend who grew up in a box goes into the technique of a big cock man .. AV application on the net → AV experience s

  • amateur censoredamateursirosiro-4365siro4365siro-4365
    • 2021-03-01
    220 min

    [SYK-003](Lust / Hunger / Sleep) This Little Kitty Is Sobbing And Cumming With Nipple Orgasmic Insane Ecstasy 21 Years Old (A Cute, Adorable Babe Transforms Into A Crazy Maso Bitch) Kurumi Suzuka (Crazy And Beautiful) A Cute Edo Local Hobbies: Watchi

  • suzuka walnut censoredcreampieamateurSYKpuramusex food and sleepshirouto only plumSYK-003SYK003h-113syk00003
    • 2021-03-19
    114 min

    [MGMQ-068]Our Slutty Teacher Loves To Break In Submissive Guys' Anal Holes With Her Strap-On! Momo Hazuki

  • hazuki peach censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-068MGMQ068mgmq00068
    • 2021-03-24
    84 min

    428SUKE-066 [Frustrated Gal = Continuous Exciting Squirting] Only Squirting Gal Wins! !! Even a gal who loves boyfriend is dissatisfied with his boyfriend! ？？ Excited about the big dick of a sex expert! Erotic flood w neck strangling vaginal cum shot

  • amateur censoredcreampiesquirtingsukesuke-066suke066428suke-066
    • 2021-04-15
    136 min

    [MKON-050]The Story Of How The Girl I Was In Love With Forever Was Stolen By Another Man Right After We Started Dating Chiharu Sakurai

  • chiharu sakurai censoredcreampieuniformMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-050MKON050mkon00050
    • 2021-05-07
    170 min

    [JUFE-288]Older Guy's POV: Sticky, Sweaty, Passionate Fucks Filmed - Dripping Body Fluids Rina Takase

  • rina takase censoredcreampiebig titsJUFEfitchJUFE-288JUFE288jufe00288
    • 2021-05-21
    38 min

    494SIKA-087 [Leaked] Private 3P video of half beauty

  • amateur censoredcreampieamateursikasika-087sika087494sika-087
    • 2021-05-22
    121 min

    [NSPS-994]She Was Annoying Me So I Fucked Her Wife Gets Soaked Rika Aimi

  • rumi tadami censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-994NSPS994nsps00994
    • 2021-05-29
    35 min

    FC2PPV 1841563 [Business trip orgy] Local advertising agency Event planning department OL 2 people x Chararyman 3 people ② [High image quality]

  • amateur uncensoredfc2
    • 2021-06-01
    140 min

    [SDNM-281]This MILF Leaks Breast Milk When She Cums - Azumi Suzuhara, Age 27, Final Chapter - She's Ready For K*d Number Two With All The Creampie Sex She's Having - 17 Loads, 8 Cocks, Fucked Right At Home While Her Husband's Away, Breast

  • azumi suzuhara censoredsingle workSDNMsod createbacon tanakagenuine married woman the porn experienSDNM-281SDNM2811sdnm00281
    • 2021-07-06
    32 min

    493NAEN-084 1 liter of tide! ？？ De M college student! ？？ If you poke it, just poke it and the tide will pop out Sensitive Ma ○ Ko and Gonzo Morishita Mirei

  • amateur censoredamateurbeautiful girlnaennaen-084naen084493naen-084
    • 2021-07-10
    62 min

    383REIW-081 Riria

  • amateur censoredcreampieamateurreiwreiw-081reiw081383reiw-081
    • 2021-07-17
    115 min

    [HMN-019]I Want To Have Your Baby, Teacher ... I Was Only Intending To Have Fun And Do It That One Time, But She Kept On Luring Me To Temptation, Seriously Extracurricular After School Babymaking Sex With A Big Tits S*****t Kasumi Tsukino

  • kasumi tsukino censoredcreampiebig titsHMNhon nakahiroaHMN-019HMN019hmn00019
    • 2021-07-18
    62 min

    421OCN-023 Risa-Chan

  • amateur censoredamateurocnocn-023ocn023421ocn-023
    • 2021-08-06
    180 min

    [EYAN-172]30 Years Old, In The Height Of her Sex Drive. The Astounding J-cups Are Out Of Control. E-BODY Exclusive Housewife Debut.

  • miki shiraishi censoredbig titssingle workEYANe bodyusapyonhanazakari no tsumatachiEYAN-172EYAN172eyan00172
    • 2021-08-22
    68 min

    HEYZO 2596 Amateur Girls In School Uniforms Enjoy Lesbian Play – Asuka Uchiyama – Yu Nagata

  • asuka uchiyama yu nagata uncensoredheyzo
    • 2021-09-09
    95 min

    240TOKYO-429 Ayumi

  • amateur censoredamateurcosplaytokyotokyo-429tokyo429240tokyo-429
    • 2021-09-23
    47 min

    10musume 092321_01 The Girl On The White Bikini Suit, Swallowing Semen Hibiki Sakurano

  • amateur uncensored10musume



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online