hours more massage refre voyeur javcensored censored




FC2MIDVPPPDGMEMAVSAONEZHDKAMIAASSNIVENXMEYDVEMAMARAHMNMILKSPRDMVSDSANAWDGVHCAWD

2024-04-20
356 min

SIHB-015 A Beloved Wife Who Is Cuckold And Hidden By A Wife Is Ascended By Another Man"s Sexual Massage And Gets Stuck!？4 Family 2 Discs

  • censoredcreampieSIHBnextsix hSIHB-015SIHB015h-1664sihb00015
    • 2024-04-05
    243 min

    DOCD-012 "Reservation Half A Year Waiting Lipo Rate 100 Men"s Esthetic Store Closed Room X Forbidden Service 21"

  • takanashi yuzu aoi mirei censoredamateurcosplayDOCDdocdoc dreamDOCD-012DOCD012h-1711docd00012
    • 2024-02-23
    241 min

    MBM-803 In A Situation Where You Can"t Speak ... The Women Who Are Cuming Are So Crazy That They Feel Crazy ... Pressing Their Voices And Fainting In Agony ...12 People 4 Hours

  • censoredslutnurseMBMmbmsasazuka garouMBM-803MBM803h-460mbm00803
    • 2023-05-27
    300 min

    BDSR-501 Men"s Massage Parlor Voyeur 50 People 5 Hours I Gave A Creampie To A Married Woman Esthetician.

  • censoredBDSRbig mocaljiro kanekoBDSR-501BDSR50157bdsr00501
    • 2023-04-08
    242 min

    YLWN-255 Asian Men'S Spa Full Voyeur Camera 4 Hours

  • censoredamateurYLWNyellow moonpatpong tateishiYLWN-255YLWN255ylwn00255
    • 2023-03-11
    240 min

    YLWN-253 Persuade A Married Masseuse And Negotiate For Creampied Sex! 4-Hour Live Broadcast

  • censoredamateurYLWNyellow moon iero mu npatpong tateishiyellow moonYLWN-253YLWN253ylwn00253
    • 2023-02-18
    359 min

    DAMX-003 Business Trip Men'S Spa Voyeur Vol.02

  • censoredamateurDAMXdama chanDAMX-003DAMX003h-1647damx00003
    • 2023-02-11
    240 min

    YLWN-250 A Beautiful Mature Woman Who Was A Masseuse Seen An Erection And Got My Sexual Desire Processed... 4 Hours

  • censoredamateurYLWNyellow moon iero mu npatpong tateishiyellow moonYLWN-250YLWN250ylwn00250
    • 2022-05-05
    240 min

    STSK-025 Peeping At An Aroma Body Therapy Salon During An Oil Massage. 4 Female Patrons.

  • censoredcreampieamateurSTSKamateur 39STSK-025STSK025h-1605stsk00025
    • 2022-04-23
    239 min

    OKAX-836 Peeping At A Massage Parlor For Female Office Workers In The Business District. 4 Hours.

  • censoredOKAXk m producedick mandokuokazuOKAX-836OKAX836okax00836
    • 2021-11-20
    240 min

    [OKAX-790]Show Your Erect Dick And Negotiate For 4 Hours In A Fully Private Men"s Esthetic Salon

  • censoredamateurOKAXk m producedick mandokuokazuOKAX-790OKAX790okax00790
    • 2021-05-14
    244 min

    [SKMJ-166]Happy Endings Are Against The Rules At This Men's Massage Parlor, But After 3 Months This Gorgeous Slut Is Willing To Make Exceptions For Loyal Customers - Her Secret Raw Creampie Sex Options Filmed On Hidden Cameras

  • censoredcreampieamateurSKMJred face girlSKMJ-166SKMJ166h-1324skmj00166
    • 2021-01-20
    240 min

    [MGDN-145]A Mature Auntie With A Ripe Body's Massage Shop, 240 Min.

  • rei higuchi yoshinori yoshino censoredmature womanMGDNstar paradisemegadonMGDN-145MGDN145h-254mgdn00145
    • 2020-12-20
    240 min

    [MGDN-143]These Mature Woman And Married Woman Babes Were Entrapped, Given Sensual Massage Treatment, And Ordered To Suck Other Men's Cocks, And Film Creampie Raw Footage 240 Minutes

  • censoredamateurMGDNstar paradisemegadonMGDN-143MGDN143h-254mgdn00143
    • 2020-12-20
    240 min

    [TKBN-021]One Single Curtain？ With Her Boyfriend Right Beside Her! Savor The Thrill Of Sneaky SEX 240 Minutes

  • censoredamateurTKBNstar paradisetreasure shipTKBN-021TKBN021h-254tkbn00021
    • 2020-12-06
    240 min

    [YLWN-144]Busty MILFs Only! Can You Tempt A Business Hotel Massage Girl Into Sex？ 240 Minutes

  • censoredamateurmature womanYLWNyellow moonpappan tateishiYLWN-144YLWN144ylwn00144
    • 2020-11-01
    240 min

    [SCR-256]Totally Private Salon - Posting Personal Footage, Highlights Collection - 4 Hours - Every Single Customer Comes Back For More - Do You Indulge In Illicit Sex Or Not？ It's All Up To You-

  • censoredcreampieblowjobSCRglay zs crimeSCR-256SCR25612scr00256
    • 2020-10-31
    237 min

    [CLUB-619]Big Tits Swimsuits Gals Only - Beachside Picking Up Girls Massage Parlor 19

  • censoredbig titsCLUBhentai shinshi kurabuCLUB-619CLUB619club00619
    • 2020-10-23
    243 min

    [GIGL-622]Voyeur - Female Specialized Oil Massage Shop -

  • censoredmature womanGIGLgigolo gigolojun nagasawagigoloGIGL-622GIGL622h-860gigl00622
    • 2020-05-29
    240 min

    [OKAX-622]Beautiful Mature Woman Without Thinking I Touched The Older Massage Instructor With Fine Ass 240 Minutes

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-622OKAX62284okax00622
    • 2020-05-20
    240 min

    [TKBN-014]Married But Fucked By Another Man... 240 Minutes Of A Neat And Clean Married Woman's Secret Sexual Desires Exploding On Screen

  • censoredTKBNstar paradisetreasure shipTKBN-014TKBN014h-254tkbn00014
    • 2020-05-03
    240 min

    [YLWN-117]I Got My Mother-In-Law Tipsy And Teased Her By Touching Her Butt And Boobs. But Instead Of Scolding Me In A Panic, She Started To Moan...

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-117YLWN117ylwn00117
    • 2020-03-28
    237 min

    [CLUB-610]Big Tits Swimsuits Gals Only - Beachside Picking Up Girls Massage Parlor 18

  • censoredbig titssquirtingCLUBhentai gentleman clubCLUB-610CLUB610club00610
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2020-02-07
    242 min

    [HEZ-137]This Married Woman Massage Parlor Therapist Couldn't Say No, So We Secretly Filmed Ourselves Having Super Secret Creampie Sex With Her 20 Super Select Ladies 4-Hour Special

  • censoredcreampieHEZhot entertainmentno directorhitotzuma hot entertainmentHEZ-137HEZ13759hez00137
    • 2020-01-25
    238 min

    [CLUB-605]The Treatment room which the Female Teacher uses for Chiropratic Therapy 26

  • censoredCLUBhentai shinshi clubno directorCLUB-605CLUB605club00605
    • 2019-11-08
    297 min

    [EQ-486]At This Erotic Oil Massage Parlor, These Early 20s Female Customers Are Getting Massive Loads Of Aphrodisiacs Massaged Into Their Bodies Until They Start To Lose Their Minds And Getting Their Big Tits Fondled While Having Creampie Sex, And We

  • natsuho imai censoredcreampiebig titsEQbrittshuzo kuriyamaimpulseEQ-486EQ486h-100eq00486
    • 2019-11-01
    241 min

    [BUR-535]Whether You Can Fuck Her Or Not Is Up To You! Sexual Negotiations With A Pushover Massage Parlor Therapist Peeping Videos 4 Hours

  • censoredcreampiebig titsBURglay zburst graceBUR-535BUR53512bur00535
    • 2019-09-13
    236 min

    [RIX-069]Private Room Schoolgirl Sexual Massage Peeping 3

  • censoredamateurbeautiful girlRIXprestigerelaxation roomRIX-069RIX069118rix00069
    • 2019-08-31
    237 min

    [CLUB-577]The Total Domain Of Girls In Uniform And Knee-High Socks They Giving Me A Dirty Talk Footjob And Forced Me To Cum Over And Over Again.

  • censoredCLUBhentai shinshi clubCLUB-577CLUB577club00577
    • 2019-07-27
    237 min

    [CLUB-572]We Secretly Filmed This Girl Showing Off Her Amazing Technique After Tweaking Your Nipples Until They're Rock Hard She'll Tease You With A Slow Oil Handjob To Bring You To The Upper Limit And Then She'll Empty Your Balls Dry Wit

  • censoredsluthandjobCLUBhentai shinshi clubCLUB-572CLUB572club00572
    • 2019-07-05
    245 min

    [DNW-040]After She Puts On Her Uniform 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-040DNW040118dnw00040
    • 2019-06-22
    240 min

    [BDSR-394]Amateurs Only. Business Trip Men's Massage Parlor Peeping 14 Women 4 Hour Highlights I Came In A Hidden Big Tits Married Woman Aesthetician 2

  • censoredcreampiebig titsBDSRbig morkalbigmorkalBDSR-394BDSR39457bdsr00394
    • 2019-06-07
    262 min

    [DNW-036]I Forgot To Turn Off These POV Videos 9

  • censoredcreampiebig titsDNWprestigedocument nowDNW-036DNW036118dnw00036
    • 2019-05-31
    240 min

    [OKAX-507]The Naughty Chiropractic Massage Parlor Where Office Ladies From Yaesu, Ikebukuro And Shinjuku Squirm With Pleasure. 4 Hours

  • censoredOKAXk m producedick mandokuokazuOKAX-507OKAX50784okax00507
    • 2019-05-10
    292 min

    [EQ-454]This Fresh Face Beautiful Mature Woman Massage Therapist Was Not Sure What To Do When Her Young Customer Got A Hard On, But She Decided To Give In To Her Desires Anyway, And It's All Captured On This Voyeur Video

  • censoredcreampiebig titsEQbullittimpulseEQ-454EQ454h-100eq00454
    • 2019-05-05
    239 min

    [YLWN-068]Thirsty Housewives Panicked After Being Molested At A Popular Massage Parlor, 4 Hours

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-068YLWN068ylwn00068
    • 2019-03-30
    236 min

    [CLUB-548]Rejuvenation Massage Parlor With Fuckable Married Women 23: Creampie Negotiations Secretly Filmed

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-548CLUB548club00548
    • 2019-03-01
    263 min

    [DNW-024]Peeping On A Shibuya Slick And Slippery Oil Massage Parlor 06

  • censoredcreampiebig titsDNWprestigedocument nowDNW-024DNW024118dnw00024
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-02-08
    484 min

    [MZQ-074]All Girls Available For Creampie Sex!! A Bad Girl Massage Parlor In Adachi Ward The Seriously Best Hits Collection (Seriously) 8 Hours

  • censoredcreampieblowjobMZQprestigemagic qaulityMZQ-074MZQ074118mzq00074
    • 2019-02-03
    240 min

    [YLWN-056]The Reason Why This Massage Parlor Staffed By Ladies In Yukata Kimonos And Housed In A Rundown Building Doesn't Go Out Of Business Is Because Of Their ** Services! 4 Hours

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-056YLWN056ylwn00056
    • 2019-02-03
    239 min

    [YLWN-057]She's A Neat And Clean Married Woman But When She Gets Toyed With In Her Sensitive Areas Her Asshole Begins To Throb With Passion At This Hot Pranks Massage Parlor 4 Hours

  • censoredmature womanYLWNyellow moonpappan tateishiYLWN-057YLWN057ylwn00057
    • 2019-01-26
    236 min

    [CLUB-532]The Treatment room which the Female Teacher uses for Chiropratic Therapy 21

  • censoredbig titsCLUBhentai shinshi clubCLUB-532CLUB532club00532
    • 2019-01-20
    240 min

    [MGDN-098]The Filthy Treatments Make Middle-Aged Women Orgasm!! Mature Women Receive Sexual Massages From A Wicked Masseuse Part 2. 12 Women, 240 Minutes

  • censoredmature womanMGDNstar paradisemegadonMGDN-098MGDN098h-254mgdn00098
    • 2019-01-11
    262 min

    [RIX-063]Creampie Raw Footage Orgasmic Peak Sex With A Beautiful And Happy Customer Who Is About To Get Married!! What Happened At The Bridal Massage Parlor

  • censoredcreampiebig titsRIXprestigerelaxation roomRIX-063RIX063118rix00063



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online