infidelity housewife censored creampie javcensored




FC2HMNSQTEGVHSSNIPREDROYDPPPDAVSASANMIAAVEMAGMEMHDKAAPODCESDNNPJAUKSJULSHKDONEZ

2020-10-17
120 min

[OKSN-307]Stepfamily Threesome - Creampie Sex

  • censoredcreampieOKSNabc mousouzokuokasan.comOKSN-307OKSN307oksn00307
    • 2020-11-03
    72 min

    Pacopacomama 110320_379 Nao Nishioka

  • nao nishioka uncensoredcreampieblowjobpacopacomama
    • 2020-11-03
    66 min

    SIRO-4302 [First shot] [Smooth young skin] [Excited about fetishism] Due to her shy personality, she has a smooth and beautiful naked body. In the first shooting that I applied to cover too little experience .. Application amateur, first AV shooting

  • amateur censoredamateursirosiro-4302siro4302siro-4302
    • 2020-11-12
    65 min

    [NYH-052]My Sister's Friend Kept Tempting Me With Pantyshots Under Her Miniskirt, So I Flipped Up Her Skirt And Stuck A Vibrator Up There While She's S******g Next To My Sister. Sana Yotsuba

  • sana yotsuba censoredNYHdirectorsdirectorsnyanjiang houseNYH-052NYH0521nyh00052
    • 2020-11-14
    62 min

    H0930 ki201114 Gold Pack 20years old

  • amateur uncensoredh0930
    • 2020-11-21
    65 min

    [tkwa-132]まこ＆さや

  • amateur censoredcreampieschoolgirltkwatkwa-132tkwa132tkwa-132
    • 2020-11-22
    239 min

    [REXD-343]Channeling Worried Women Immoral Palm Reading Fortune Teller's Sexual Aura "I Sense A Bad Spirit Coming From You..."

  • censoredcreampieamateurREXDredmanji groupREXD-343REXD343rexd00343
    • 2020-12-09
    26 min

    FC2PPV 1599927 Limited to 300 [Individual] Mother of three children with tall legs, drink 〇 and commit

  • amateur uncensoredfc2
    • 2020-12-12
    112 min

    390JAC-075 [G huge breasts cheer girl x 5 vaginal cum shot] Pai slash! !! Big breasts RUSH on the verge of explosion! G huge breasts that shake swaying Japan! Good to touch! Good to see! It’s okay to massage! Don’t miss the strongest rampag

  • amateur censoredcreampiebig titsjacjac-075jac075390jac-075
    • 2020-12-13
    26 min

    FC2PPV 1605539 Everyone! Subjective Gonzo video in a lover style! As for the review privilege, I read the impression of the review by one person etch!

  • amateur uncensoredfc2
    • 2020-12-30
    75 min

    326EVA-160 4 barrages in Super Domaso GAL! !! A non-standard girl’s bar clerk who likes strangling and deep throating. Chi ● Po-dependent gal’s vagina in the generalized erogenous zone. 4 consecutive shots SEX that covers your face and face

  • amateur censoredcreampieamateurevaeva-160eva160326eva-160
    • 2021-01-08
    32 min

    [BTH-107]Embarrassing Dirty Talk Koko Seko

  • seko here censoredbeautiful girlBTHchobitchchovicBTH-107BTH107h-1435bth00107
    • 2021-01-12
    138 min

    [KMHRS-037]Peaceful Living, Nice Fucking. A Simple Girl's AV Debut, with Misuzu Miyamori

  • misuzu miyamori censoredamateurblowjobKMHRSsod creatememe akiyamakimihoreKMHRS-037KMHRS0371kmhrs00037
    • 2021-01-13
    42 min

    230ORE-737 Mitsuki 6

  • amateur censoredcreampieschoolgirloreore-737ore737ore-737
    • 2021-01-23
    135 min

    [JUL-442]A Revival Of An Exclusive Madonna Label Actress No.2!! I Went On A Business Trip With My Favorite Lady Boss, And To My Surprise, We Were Booked Into The Same Room At A Business Hotel Asahi Mizuno

  • mizuno chaoyang censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-442JUL442jul00442
    • 2021-02-01
    118 min

    [GAS-482]Breast Milk, Colossal Tits, Hinami: 1 Liter Of Breast Milk - Hinami Naruse

  • hinami narusawa censoredbig titsmature womanGAScinema unit gasakira takatsukigasGAS-482GAS48271gas00482
    • 2021-02-06
    170 min

    [HUNBL-032]Girl Without Memories

  • censoredcreampiedeepthroatHUNBLhuntergeminihhh groupHUNBL-032HUNBL032hunbl00032
    • 2021-02-06
    190 min

    [HUNTA-945]This Big Stepsister And Little Stepbrother Are Secretly Fucking Behind Their Stepparents' Backs! When Their Stepparents See Them, They Fight On Purpose. But The Truth Is That They're More Than Just Step Siblings, Because The Instan

  • censoredcreampiesisterHUNTAhunterrobby kunhhh groupHUNTA-945HUNTA945hunta00945
    • 2021-02-11
    54 min

    FC2PPV 1681070 [No appearance, individual shooting, newlywed NTR, stakeout cowgirl w] The small devil slut play of a beautiful busty wife who is about to get married is too erotic w If you make SEX your husband, you will stop in agony! Uncle tuna is

  • amateur uncensoredfc2
    • 2021-02-12
    150 min

    [MIFD-147]We Can't Tell You The Name Of The Shop, But This 20-Year-Old Fresh Face Works At A Vintage Clothing Store In Koenji - Chubby, Stylish Cutie With Short Hair That Suits Her Makes Her Porn Debut! Tsugumi Makoto

  • makoto tsugumi censoredsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-147MIFD147mifd00147
    • 2021-02-13
    58 min

    Pacopacomama 021321_434 Horny mid-age woman who wants to be on top during sex Runa Akasaka

  • amateur uncensoredpacopacomama
    • 2021-02-20
    97 min

    [IMOTA-008]I Tried To Make My Nerdy Loser Stepsister A Little Sexier And She Transformed Into A Raging Slut. Aria Aimi

  • aimi censoredblowjobsisterIMOTAstar paradisesister eggIMOTA-008IMOTA008h-254imota00008
    • 2021-02-25
    121 min

    [FSDSS-179]A Fresh Face This 20-Year Old Wants To Fuck 365 Days A Year Her Adult Video Debut Noa Miura

  • miura noai censoredbig titssquirtingFSDSSfalenodragon nishikawafaleno starFSDSS-179FSDSS1791fsdss00179
    • 2021-03-18
    477 min

    [OFJE-304]Gorgeous Big Tits Bouncing All Over The Place! All G-Cup And Bigger Actresses Ride Dick Until They Cum 50 Rounds

  • arisu aka jun jun censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-304OFJE304ofje00304
    • 2021-04-01
    49 min

    10musume 040121_01 Perverted easy girl who became a hyper groovy Kumi Tsukino

  • amateur uncensored10musume
    • 2021-04-04

    FC2PPV 1753654 Limited number [Uncensored] Super slender JD, cum shot at the hotel from a night cafe date

  • amateur uncensoredfc2
    • 2021-04-10
    44 min

    H4610 ki210411 Ayumi Nakamura 24years old

  • amateur uncensoredh4610
    • 2021-04-10
    154 min

    [CESD-991]We Film Whatever Kana Morisawa Wants To Do Kana Morisawa

  • kana morisawa kanako iioka censoredcosplaymature womanCESDceleb no tomoCESD-991CESD991cesd00991
    • 2021-05-01
    200 min

    [HUNBL-044]Rough Gagging Face Fucking + Premature Ejaculation Deep Throating

  • censoredcreampieHUNBLhuntergeminihhh groupHUNBL-044HUNBL044hunbl00044
    • 2021-05-10
    61 min

    SIRO-4520 [First shot] [SS-class naive G cup] [Extremely naive naked body] A naive girl who has just turned 20 wants to do something different than usual! And participated in AV shooting. A must-see SEX full of the first experience of active JD that

  • amateur censoredbig titsamateursirosiro-4520siro4520siro-4520
    • 2021-05-26
    49 min

    481SACZ-033 Yuko 5

  • amateur censoredmarried womanamateursaczsacz-033sacz033481sacz-033
    • 2021-06-10
    134 min

    FC2PPV 1861454 Former idol * Limited quantity * Early purchase recommended *

  • amateur uncensoredfc2
    • 2021-07-02
    119 min

    [JUL-636]No Matter What Happens I Can't Tell My Wife I Impregnated My Mother-in-Law... I Lost Control Of Myself And Fucked My Mother-in-Law Raw For One Day And Two Nights On A Trip To The Hot Springs Honoka Yonekura

  • hoika yonekura censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-636JUL636jul00636
    • 2021-07-18
    240 min

    [MKMP-408]2020 User Approval Rate: BEST 4 Hours Of The Year - The Most Replayed Top 20 TItles

  • sakura kizuna miku abe censoredcreampiebig titsMKMPkm producetaro kmillionMKMP-408MKMP408mkmp00408
    • 2021-08-29
    43 min

    229SCUTE-1121 Mari (19) S-Cute Irama-Loving Girls’ Rich Sex

  • amateur censoredcreampiesquirtingscutescute-1121scute1121229scute-1121
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-11
    163 min

    [URPW-053]A Free-For-All Fuck Fest With Our Favorite Big Tits Waitress! I Had All The Ejaculations And Creampie Sex I Could Ever Want With These 3 Divine Titty Babes Ruka Inaba Sarina Momonaga Mizuki Yayoi

  • inaba sarina momonaga censoredcreampiebig titsURPWunfinishedrolandoppainURPW-053URPW053urpw00053
    • 2021-09-19
    91 min

    FC2PPV 2219891 [New Work, Half Price! ] ♀326 Female College Student Mi ◯ -Chan 20 Years Old 1st Time First Shot! Tall Slender F Cup Beauty Busty Beautiful Girl Jd Of Model Body Appears In Av With A Complete Appearance Without Telling Her Boyfriend An

  • amateur uncensoredfc2
    • 2021-10-16
    241 min

    [KSBJ-163]Plump Legend Mature Woman BEST 12 People

  • shota chisato natsuko kayama censoredbig titsmature womanKSBJksb planning emanuelKSBJ-163KSBJ163ksbj00163
    • 2021-10-21
    71 min

    435MFC-152 [Men’s Eating Ma ○ Ko] Creampie Sex With An Intellectual Metamorphosis Older Sister Who Messes Around With The Guys Around Her And Seduces Her To Ma ○ Ko And Controls Her Real Power! [Shiroto Gonzo ＃ Here ＃ 29 Years Old ＃ All Male Fri

  • amateur censoredcreampiebig titsmfcmfc-152mfc152435mfc-152
    • 2021-10-28
    125 min

    [AARM-029]AJOI Ultimate Total POV Masturbation Support DVD Original 2 Aromatic Jerk Off Instruction

  • chiharu miyazawa arimura nozomi censoredanalAARMaroma kikakusatoshimaniaaromaAARM-029AARM029aarm00029
    • 2021-12-04
    140 min

    [BAHP-095]My Friend Works At An Adult Video Label, And He Asked Me, "Hey, Can I Use Your Place To Do Some Filming？ This Video Will Cum With Special Features, Like You Can Fuck A Famous Adult Video Actress All You Want." And That"s How He

  • natural mizuki censoredbeautiful girlslutBAHPbaltandaibutsu yoshidahoppinBAHP-095BAHP095bahp00095
    • 2021-12-07
    98 min

    300MAAN-725 [Absolute Obedience Doggie Bitch Dental Hygienist] Bottomless Sexual Desire That Does Not Stop In Search Of Rich Sperm! !! Do м Constitution That Wants To Gokkun With A Cute Face & Wants To Exhaust! !! 3 Shots Inevitable In Agony In A

  • amateur censoredcreampieamateurmaanmaan-725maan725300maan-725
    • 2021-12-10
    119 min

    [JUL-797]My Stepson"s Friends Continue to Make Me Come Via Their Uncontrollable, Unequaled Fucking... Yumi Kazama

  • kazama yumi censoredbig titsmature womanJULmadonnaamazing meatJUL-797JUL797jul00797
    • 2021-12-16
    68 min

    FCP-060 [Distribution Only] Stared By A Naughty Older Sister, Whispered And Fired … Super Shinto Handjob ＃ 2 (Kozue Minami Rinka Momose Kanon Tani)

  • amateur censoredamateurhandjobfcpfcp-060fcp060fcp-060
    • 2021-12-21
    59 min

    H4610 ki211221 Megu Iwanaga 25years old

  • amateur uncensoredh4610



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online