jav delusion group censored javcensored documentary




FC2CJODAMBISPRDSHKDPPPDSQTESSISMIDEWAAASANGMEMMARAIPXONEZMILKHMNEBODATIDAUKGBBAN

2020-10-22
73 min

AVKH-181 Akari Tomooka

  • amateur censoredbig titsamateuravkhavkh-181avkh181avkh-181
    • 2020-10-24
    120 min

    [JUL-350]While My Colleagues Went On A 3-Day, 2-Night Company Trip, I Was Ordered To Stay Behind, And I Was Stuck At The Office, With My Favorite Receptionist... Airi Kijima

  • airi kijima censoredmature womansingle workJULmadonnasatsugu koyamaJUL-350JUL350jul00350
    • 2020-10-25
    118 min

    [XVSR-559]Complete POV: Full View Of Beautiful Big Tits! No Bra Sister Mao Kurata

  • kurata mao censoredcreampiebig titsXVSRmax aikuzo yoshidacalenXVSR-559XVSR559xvsr00559
    • 2020-10-25
    158 min

    [SAL-247]I Met Up With My Little Stepbrother And My Colleague For The First Time In Years, And They Were Now Transsexual Bitches... I Ejaculated My Entire Load In Deep And Rich Anal Sex x Reverse Anal Sex

  • chuzawa nakazawa hoshigoe kaname censoredSALshemale a la carteSAL-247SAL247sal00247
    • 2020-11-05
    34 min

    FC2PPV 1559033 Creampie experiment with rubber that can be torn by a shaved girl Is rubber really torn？

  • amateur uncensoredfc2
    • 2020-11-06
    119 min

    [SSNI-910]This Boyish Barely Legal After-School Club Girl And A Middle-Aged Coach Are Rooming Together During Summer Training Camp... And This Female S*****t Is So Horny That She Paid Him A Reverse Night Visit And Hit Him With 10 Rounds Of Orgasmic E

  • kodama rena censoredbig titsbeautiful girlSSNIs1 no 1 stylerokusaburo mishimaSSNI-910SSNI910ssni00910
    • 2020-11-06
    68 min

    [FTBL-006]Pierced Tongue! Unbelievable Habits! Sunglasses At Night! Bleached Hair! Braless Tube Top! This Osaka Native With High-Class Silver Fox Accessories! Big City Bitch! "Going Down!" As Her Pierced Tongue Swirls Around Your Dick With Th

  • censoredbig titsblowjobFTBLfalenodavielfalenotubeFTBL-006FTBL0061ftbl00006
    • 2020-11-12
    123 min

    [FGAN-028]An Unexpected Erection A Beautiful Girl Bares Her Panties Mako Mako Shion

  • miko shion censoredcosplaysingle workFGANfetish eyesFGAN-028FGAN028h-1440fgan00028
    • 2020-11-13
    67 min

    259LUXU-1333 Luxury TV 1326 Its appearance is just a goddess! Nozomi Makita, a hotel front lady who is too beautiful, is back! It seems that frustration has been refined for the first time in the previous work to have sex. A sexually hungry beauty de

  • amateur censoredamateurluxuluxu-1333luxu1333259luxu-1333
    • 2020-11-13
    199 min

    [GZAP-035]Free Treatment: Playing Voyeur On A Big Tittied Office Lady We Picked Up As She Gets Hot And Wet With Love Oil In A Massage Parlor

  • censoredbig titsGZAPprestigehimu locksapGZAP-035GZAP035118gzap00035
    • 2020-11-13
    78 min

    483SGK-003 [I’m doing saffle] [Super sensitive sexual desire] [Beautiful girl camera assistant I love strangling] [Haunted cum convulsions Iki] [Dependence on throat demon Imara] I want to meet you, I like you. Shy Saffle’s Mouth And Oma Co

  • amateur censoredamateursgksgk-003sgk003483sgk-003
    • 2020-11-27
    87 min

    [sqb-077]ゆか

  • amateur censoredamateurbeautiful girlsqbsqb-077sqb077sqb-077
    • 2020-12-07
    83 min

    259LUXU-1349 Luxury TV 1336 Masturbation frequency twice daily! ？？ Is it the nature of the job of a nurse who has few encounters？ Pay attention to the appearance that the sexual desire that can not be resolved is disturbed only with Hara-san!

  • amateur censoredamateurluxuluxu-1349luxu1349259luxu-1349
    • 2020-12-08
    115 min

    [ARM-931]Guys Blow Their Loads From Face-Sitting In Panties And Being Smothered By Tits While Their Nipples Are Teased - Their Cocks Aren't Touched At All

  • yurika mine yuri sasahara censoredbig titsARMaroma planninghamu oujiaromaARM-931ARM931arm00931
    • 2020-12-09
    85 min

    [OKYH-069]Would You Go Into The Men's Bath Wearing Only A Single Towel？ ...Your Prize Money Will Double If You Take A Walk Around The Whole Hotel like That On This Thrilling Episode Of One-Way Mirror! Ssh, Keep It Down When You Get Fucked, You Do

  • censoredbig titssquirtingOKYHsod createafro takahashiwhy don t you take a men s bath with a towelOKYH-069OKYH0691okyh00069
    • 2020-12-11
    128 min

    [SCPX-415]Strip Club New Meguro DX: Secret Fucking And Cumshot Service: Winter 2020 Performance

  • censoredbig titsblowjobSCPXscoopmousouzokuSCPX-415SCPX415h-565scpx00415
    • 2021-01-15
    245 min

    [DOCP-271]I Came Back Home For The First Time In Ages Only To Find Out That My Stepsister - Who Has A Crush On Me - Is Now Hot Enough To Get Me Hard. "I Won't Tell Anyone," She Said, And Spread Her Legs For Me...

  • moe hazuki asuka hayasaka censoredcreampiebeautiful girlDOCPprestigedoc premiumDOCP-271DOCP271118docp00271
    • 2021-01-25
    67 min

    SIRO-4362 [First shot] [Female college student who likes vagina back] [Daddy service] 19-year-old simple female college student. An innocent girl climaxes many times with tears in the pleasure of her favorite vagina back .. Application amateur, first

  • amateur censoredamateursirosiro-4362siro4362siro-4362
    • 2021-01-31
    131 min

    [EMBZ-220]Married Amateur Girls Cover Their Feet For One Whole Day So That You Can Savor Their Fragrant Pantyhose...

  • asano honoka sakamoto censoredmature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-220EMBZ220embz00220
    • 2021-02-05
    57 min

    396BIG-071 Sakura (26)

  • amateur censoredcreampiebig titsbigbig-071big071396big-071
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-21
    147 min

    [CAWD-183]Fingering Her With The Cute Kansai Dialect - Twirl, Twirl - "You Can't Cum Yet!" Stuck In Between Two Kansai Girls, I Had A Reverse Threesome Until My Dick Almost Broke - Nana Maeno, Kokomi Hoshinaka

  • nana maeno kozomi hoshinaka censoredsquirtingbeautiful girlCAWDkawaiiarashiyama michiruCAWD-183CAWD183cawd00183
    • 2021-02-25
    93 min

    [OKS-106]Wet And Shiny, Perfectly Fitting Godly Swimsuit: Minano Sena Is Enjoying Her Cute Girls' School Swimsuit! This AV Starts With A Voyeur Video Of Big And Small Breasts And Moves On To A Number Of Fetish CLose-ups, Such As Shaved Pussies, H

  • minano sena censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-106OKS1061oks00106
    • 2021-03-06
    97 min

    [SHKD-936]A Pretty Girl In Pure White Gets Dirty - Sakura Tsukino

  • tsukino sakura censoredsingle workSHKDattackerssayaka datesharkSHKD-936SHKD936shkd00936
    • 2021-03-12
    243 min

    [UMSO-379]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around

  • censoredmarried womanamateurUMSOkm produceumanamiUMSO-379UMSO37984umso00379
    • 2021-03-28
    82 min

    491TKWA-066 I made a masturbation from daytime at a literary J ○ and a hook teahouse and had sex and shot a lot of facials again

  • amateur censoreduniformschoolgirltkwatkwa-066tkwa066491tkwa-066
    • 2021-04-11
    107 min

    390JNT-019 [Cum I’m Going] I ● Put an erotic selfie on the star, pick up a G milk gal on SNS! !! Transcendental squirting constitution! !! Please burn your ears with the dirty words that pop out while you have convulsions! "It’s awesome

  • amateur censoredcreampiebig titsjntjnt-019jnt019390jnt-019
    • 2021-04-22

    FC2PPV 1781883 New personal shooting Amateur active CA Due to a drastic decrease in work, a secret meeting with Succi! Part ⑤ First in-car blowjob !!

  • amateur uncensoredfc2
    • 2021-04-23
    56 min

    328HMDN-356 [Personal shooting] Beautiful slender boss’s wife 48 years old and affair Gonzo. Creampie sex where a mature woman who turned into a slut releases her libido with a young man’s cock

  • amateur censoredcreampiebig titshmdnhmdn-356hmdn356328hmdn-356
    • 2021-04-28
    58 min

    517MQXT-004 A Beautiful Girl Who Crawls On All Fours After Administration Of An Aphrodisiac And Is Asked For A Shame Hole And Shakes

  • amateur censoredschoolgirlamateurmqxtmqxt-004mqxt004517mqxt-004
    • 2021-05-14
    120 min

    [OKSN-335]A New Discovery! What A Small Waist! Such Colossal Tits! This Seriously Erotic And Beautiful Girl Has Exquisite Style To Spare, And Will Light The Furious Fires Of Her Smoldering Lust An Afternoon Love Affair

  • censoredbig titshandjobOKSNabc mousouzokuokasan.comOKSN-335OKSN335oksn00335
    • 2021-05-18
    100 min

    [STARS-375]She Won't Leave Her Futon No Matter What I Do - Once My Stepsister Goes To Bed, She's Down For The Night - No Matter How Many Times I Creampie Her Waiting Pussy! Iori Kogawa

  • iori furukawa censoredcreampiesisterSTARSsod createsoran kobayashisod starSTARS-375STARS3751stars00375
    • 2021-05-22
    240 min

    [BDSR-450]Gal's Paradise: 17 People, 4 Hours

  • censoredamateurBDSRbig morkaljiro kanekoBDSR-450BDSR45057bdsr00450
    • 2021-06-02
    63 min

    422ION-0070 Ikase Her Boyfriend With A Toy And Cum Inside As It Is

  • amateur censoredcreampiebig titsionion-0070ion0070422ion-0070
    • 2021-06-05
    240 min

    [DSD-828]Glistening Slippery Oil Fuck!! 2

  • emma hick julie cash censoredbig titsDSDmomotaro video publishingmarchinsweetdevilDSD-828DSD828dsd00828
    • 2021-06-19
    151 min

    [HND-999]"Honestly, I'd Rather Do It Without The Condom." Sensitive F-Cup College Girl's First Raw Creampie Yuika Aoi

  • yuka aoi censoredcreampiebig titsHNDhon nakausa pyonHND-999HND999hnd00999
    • 2021-07-01
    98 min

    [MESU-085]Creampie At The Office During Overtime Sex With My Older Female Superior - Misako Kiyohara

  • kiyohara misako censoredcreampiemature womanMESUcenter villagekotaro misatored snowMESU-085MESU085h-086mesu00085
    • 2021-07-03
    135 min

    [LUKE-013]Devilish And Cute S*********l Slut Loves To Seduce Men Nonoka Sato

  • is it sato censoredschoolgirlslutLUKEdigital arkdigital ark digital arkLUKE-013LUKE013luke00013
    • 2021-07-17
    299 min

    [DANUHD-009]"Only Women Who Don't Know Will Lose Out! Rika Mari Gives Blowjob On World's Biggest Dick, Gets Bukkaked And Creampied"

  • mari rika censoredcreampieblowjobDANUHDdandydandyuhdDANUHD-009DANUHD0091danuhd00009
    • 2021-08-03
    32 min

    FC2PPV 1953566 Today’S Limited [Individual Shooting] Prefectural General Course ③ Ponite Gal. School Skipping 〇 ・ Gonzo With A Flat Face ※ No Eye Moza

  • amateur uncensoredfc2
    • 2021-08-05
    243 min

    [CVDX-458]She Twisted Her Fingers Into Her Lingerie, Until She Had Stripped To Fully Naked Glory ... A Horny Housewife Undresses - A Deep And Rich Love Affair, While Secretly Peeping At Her Alluring Body - 30 Ladies 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-458CVDX458h-086cvdx00458
    • 2021-08-12
    93 min

    [OKB-117]Suzuka Ninomiya Thick And Huge Ass Godlike Gym Shorts Cute Loli Girl And Her Thick Sister Put On Tight Gym Shorts And Gym Clothes, Their Panties Peak Out, And You Can Even See The Lines Of Their Vagina Down To The Pores With These Close-Up S

  • ninomiya suzuka censoredschoolgirlsingle workOKBoyaji no kosatsukami bloomersOKB-117OKB1171okb00117
    • 2021-08-21
    147 min

    [DBER-121]Female Body Shame Institute III JUDAS FINAL STAGE Story-6 A Y********l Crying Hard At The Climax Of Shame - Natsu Tojo

  • natsu tojo censoredbdsmsingle workDBERbaby entertainmentkikubonred babeDBER-121DBER121dber00121
    • 2021-08-29
    58 min

    FC2PPV 2101721 A Girl Who Was Sleeping At An Internet Cafe. A Girl Who Couldn’t Stand The Leap By Her Father-In-Law And Left Home With Loneliness And Despair. She Licks Her Unfinished Body And Makes A Lot Of Vaginal Cum Shot In Her Immature Puss

  • amateur uncensoredfc2
    • 2021-09-02
    58 min

    [090221_001]何故、そんなに乳首がビンビンなの？

  • amateur uncensored1pondo
    • 2021-09-03
    166 min

    [JUFE-325]A Hidden Inn Limited To One Group Per Day! Ichika Seta, The Best Sex Inn Where The Host Always Treats Your Rod With Care

  • kazuhana seta censoredcreampiebig titsJUFEfitchJUFE-325JUFE325jufe00325



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online