javcensored jav censored delusion grou




FC2MIDVMVSDJULADNGMEMHDKAVENXGVHSQTEFSDSSPREDAVSAMILKAWDMARAIPXSHKDCHRVSDABAUKG

2020-12-12
64 min

[201DORI-003]パコ撮り No.03 美スタイルなプリ尻の肉感港南口勤めOL敏感乳首を勃起させ焦らされ「入れて～！」と叫び股を広げておねだりした！

  • amateur censoredamateurdoridori-003dori003201dori-003
    • 2021-01-05
    60 min

    10musume 010521_01 I longed to read the restraint play of porn books for the first time in junior high school UEMOTOYURI

  • amateur uncensored10musume
    • 2021-01-12
    74 min

    [BTHA-060]Hair Nude: Uncensored Cute Faith , Slim Beautiful Girl Hikaru Konno

  • hikaru konno censoredbeautiful girlsingle workBTHAsupa kubijonBTHA-060BTHA0605433btha00060
    • 2021-01-24
    120 min

    [AGAV-047]This Natural Airhead Lolita Babe Has The Greatest I-Cup Colossal Tits I Oiled Up This Fully Clothed Princess' Titties And Satisfied Myself From All Angles And Now My Life Is Complete Hana Himesaki

  • himesaki hana censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-047AGAV047agav00047
    • 2021-02-11
    136 min

    [NEO-753]Armpit Sweat And Semen - Tsukasa Nagano

  • tsukasa nagano censoredsingle workNEOradixshio sakurabaneo paradoxNEO-753NEO753433neo00753
    • 2021-02-12
    85 min

    [ZOZO-041]Miss Mio Ichijo

  • censoredcreampiebig titsZOZOsadie willenauZOZO-041ZOZO0411zozo00041
    • 2021-02-12
    135 min

    [BOKD-213]Natural Crossdresser: Breaking In Debut - Current University S*****t, Rika

  • rika censoredcreampieBOKDour man s daughterdorkawaBOKD-213BOKD213h-995bokd00213
    • 2021-02-18
    41 min

    FC2PPV 1690754 [W brush grated GET] Poke-nma-i & Pika-yu! It feels so good at the first insertion that I can not stand it and inadvertently shoots vaginal cum shot! ？？ Double Virgin-kun Cosplay Creampie Graduation! * Complete appearance

  • amateur uncensoredfc2
    • 2021-02-19
    87 min

    [SS-016]Clarity Hikari Azusa

  • censoredcreampieschoolgirlSSglory questSS-016SS016h-113ss00016
    • 2021-02-20
    44 min

    FC2PPV 1694980 * Uncensored * Appearance * Scheduled to end early! !! Gonzo permission to leak! ？？ Active race queen has a complete appearance and vaginal cum shot SEX ♡ There is a luxurious review privilege ♡

  • amateur uncensoredfc2
    • 2021-02-21
    120 min

    [JUL-479]During Our Business Trip, To My Great, Great, Surprise, I Was Booked Into The Same Business Hotel Room With My Favorite Lady Boss Honoka Kimura

  • honoka kimura censoredmature womansingle workJULmadonnamametaro mamezawaJUL-479JUL479jul00479
    • 2021-02-25
    483 min

    [FCDSS-007]Ayaka Tomoda FALENO Her First Best Hits Collection 8 Hours 40 Cum Shots Of Super Tempting Semen Sucking Sex!! + Previously Unreleased POV Videos Of Real Sex

  • ayaka tomoda censoredslutsingle workFCDSSfalenofaleno starFCDSS-007FCDSS0071fcdss00007
    • 2021-02-25
    107 min

    [SPRD-1381]So Much Better Than My Husband's... - Hitomi Hitachi

  • hitachi hitomi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1381SPRD138118sprd01381
    • 2021-03-06
    200 min

    [HUNTA-964]"Oh My God! It's So Big! Please Let Me Lick It, Just For A Little While!!" The Second You Get An Erection, It's Game Over, Because Your Big Stepsister Will Beg You Over And Over Again, And Give You A Blowjob Even While You&

  • censoredcreampieblowjobHUNTAhuntermorikihhh groupHUNTA-964HUNTA964hunta00964
    • 2021-03-09
    48 min

    FC2PPV 1718846 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Active underground idol pillow business for money! ♥ ️ Dosukebe Gonzo ♥ ️ A large amount of vaginal cum shot in a gyukyu pussy! !! ♥ ️ * Review benefits / Legs jerky with denma

  • amateur uncensoredfc2
    • 2021-03-18
    50 min

    H4610 ki210318 Asuka Kasakura 18years old

  • amateur uncensoredh4610
    • 2021-03-21
    34 min

    490FAN-075 Nana

  • amateur censoredamateurfanfan-075fan075490fan-075
    • 2021-03-24
    62 min

    SIRO-4467 [First shot] [Professional student injured] [Begging with a shameful face] "I can’t even watch a romance movie .." 20-year-old young body is an adult technique .. AV application on the net → AV experience shooting 1490

  • amateur censoredsquirtingamateursirosiro-4467siro4467siro-4467
    • 2021-03-27
    146 min

    [XVSR-585]The Masked Couple ~ Women Who Fuck And Women Who Get Fucked ~ Complete Version Azusa Misaki Nozomi Arimura

  • misaki azusa arimura nozomi censoredcreampiedramaXVSRmax ak c takedacalenXVSR-585XVSR585xvsr00585
    • 2021-04-02
    67 min

    FC2PPV 1751646 * Weekend limited 6000⇒3980pt ★ Premier amateur ☆ Ultimate erotic BODY ♥ Little devil girl reappears! Hime-chan 21 years old ☆ Mischievous best blowjob ♥ Raw Saddle pleasure continuous Iki ♥ Beauty BODY violently faints in agony mass c

  • amateur uncensoredfc2
    • 2021-04-04
    47 min

    FC2PPV 1754740 Up to 11 1480 [No] Big breasted slender toys. It is made to give in by force and vaginal cum shot is made continuously.

  • amateur uncensoredfc2
    • 2021-04-14
    63 min

    FC2PPV 1768328 Mirei 21 years old Idol-class cuteness and gravure model-class style! A transcendental beauty job hunting student who embodies all the sexual desires of a man! G cup big breasts x plump big ass body with seeds and vaginal cum shot!

  • amateur uncensoredfc2
    • 2021-04-24
    125 min

    [MMUS-052]A Beautiful Little Devil's Provocation: Ayumi Aika

  • ayumi aika censoredslutsingle workMMUSmarrionkijin kasaikcpMMUS-052MMUS052mmus00052
    • 2021-04-26
    90 min

    FC2PPV 1787200 [Individual shooting 37] Complete appearance 20 years old Legal Lori Paipan Serika ③ 2 Reinjection after continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    123 min

    [IPX-665]I Hate My Boss' Guts, But Now We're On A Business Trip Together, And To My Shock And Horror, We've Been Booked Into The Same Room At The Hot Spring Resort Inn ... This Ugly And Disgusting Horny Old Man Made Me Cum Over And Over A

  • airi kijima censoredcreampiesingle workIPXidea pocketdishIPX-665IPX665ipx00665
    • 2021-05-07
    168 min

    [IPX-660]If You Don't Want To Get Into Trouble, Then Take Off Your Panties. Dirty Shoplifting Gals ... The Tragedy Of Relentless Piston-Pounding Pussy Pumping That Won't Ever Stop, No Matter How Many Times He Cums, And He Won't Ever Let H

  • kana momonogi censoredblowjobbeautiful girlIPXidea pocketkyoseidishIPX-660IPX660ipx00660
    • 2021-05-25
    55 min

    FC2PPV 1835787 Kimi, it’s almost like letting me be youth like this 2 ♪ Rokuki Layer-san Nakashi Nakashibe Echiechi Unipaisen Part2

  • amateur uncensoredfc2
    • 2021-06-16
    27 min

    FC2PPV 1871208 Up to 23 1280 [Leaked] A junior at a fair-skinned workplace. She is suspicious of the camera but she is swept away by her atmosphere and vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-06-18
    88 min

    [OHP-1003]Rin Yuki/100 Beautiful Girl

  • yuki rin censoredbeautiful girlsingle workOHPmedia brand100 hottie media brandOHP-1003OHP1003301ohp01003
    • 2021-06-29
    84 min

    274DHT-0099 Eliminate the stress of husband & childcare with 3P! Azusa 29 years old & Maho 27 years old

  • amateur censoredmarried womanamateurdhtdht-0099dht0099274dht-0099
    • 2021-07-14
    57 min

    510ELLO-012 Concafe Nampa Mikuru chan

  • amateur censoredamateurelloello-012ello012510ello-012
    • 2021-07-20
    99 min

    [OFKU-186]How Do I Convince The Horny Beautiful Wife In A Tight Miniskirt Who Lives In The Same Apartment Complex As Me To Fuck？! Naho Yozora 41 Years Old

  • naho yozora censoredcreampiebig titsOFKUstar paradisemom railOFKU-186OFKU186h-254ofku00186
    • 2021-08-14
    128 min

    [SORA-328]My Young Step Niece Came And Visited For A Vacation In The Country, So I Decided To Take Her By The Hand And Put Her Through Exhibitionist Training. She Became Hooked On Shameful Pleasure, And Began To Beg Me, "Please Watch Me In My Sha

  • marina saito censoreduniformschoolgirlSORAyama to sorausubashi suiSORA-328SORA328sora00328
    • 2021-09-03
    120 min

    [MIDE-967]"May I Bring Over My Maso Manager From The Store？" After Closing Up Shop, This Horny Bitch Part-Time Worker Will Whisper Devilish Dirty Talk Into My Ear In An Attempt To Lure Me To Temptation, So I Answered Back With A Pussy-Poundin

  • jinguji temple nao censoredcreampieblowjobMIDEmoodyzgoemonmoodyz divaMIDE-967MIDE967mide00967
    • 2021-09-09
    93 min

    [OKS-119]Luna Tsukino. Wet Glistening School Swimsuit That Clings To Her. A Cute Girl In A Dripping Wet School Swimsuit Is The Best! Starting With An Outfit Change While Peeping, Small Tits To Big Tits, Shaved Pussy, Pussy Hair Sticking Out, Armpits

  • tsukino luna censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-119OKS1191oks00119
    • 2021-09-10
    119 min

    [IPX-730]My TSUNDERE Girlfriend Loves Getting Her Nipples Fondled. Sustained Nipple Play. Sexy Roommate Life. Tsumugi Akari

  • akari tsumugi censoredcreampieslutIPXidea pockettissueIPX-730IPX730ipx00730
    • 2021-09-17
    110 min

    [DAVK-067]Neat And Clean Shy Virgin Loses It Right After Turning 18. (Outdoor Nipple Play) (French Kissing & Blowjob For Everyone) (Nonstop Cumming by Titty Fucking) Large Orgies With 7 People. Sex Machine With Super Colossal Tits Enjoys All Out C

  • censoredcreampiebig titsDAVKtmahashida takamitsudoujin av clubDAVK-067DAVK06755davk00067
    • 2021-10-01
    181 min

    [MIAA-505]The Top Honor S*****t In My Class (The Homeroom Teacher"s Class) Is My Pet For A Blowjob. Mai Kagari

  • flower hunting censoreduniformblowjobMIAAmoodyzminna no kikatanMIAA-505MIAA505miaa00505
    • 2021-10-02
    135 min

    [GMEM-045]Female Detective Gets Captured By A Crime Group She"s Pursuing, Episode 5: Crazy Pussy Awakening, Starring Aya Shiomi

  • aya shiomi censoredbdsmsingle workGMEMavsbaba za babiiavscollector s goldGMEM-045GMEM045gmem00045
    • 2021-10-30
    73 min

    383REIW-096 Rena

  • amateur censoredcreampiebig titsreiwreiw-096reiw096383reiw-096
    • 2021-11-09
    57 min

    H0930 ki211109 Kanae Takashiro 26years old

  • amateur uncensoredh0930
    • 2021-11-12
    60 min

    230OREC-934 Uika (Noau Ika)

  • amateur censoredcreampieamateurorecorec-934orec934230orec-934
    • 2021-11-18
    30 min

    FC2PPV 2444682 Until Tomorrow! "# 14" Local Married Woman. Sexless And The First Etch In A Year. Gonzo Affair And Vaginal Cum Shot ♡ Unrequited Love ♡

  • amateur uncensoredfc2
    • 2021-11-24
    60 min

    OREX-326 Airi-chan (Airi Momose)

  • amateur censoredcreampieschoolgirlorexorex-326orex326orex-326
    • 2021-12-01
    55 min

    FC2PPV 2481390 * Limited Time Price Until 12/7 [2480pt⇒1980pt] Yeah, Yeah! Manju Is Delicious ☆ I Relentlessly Cunniling A Fresh Teenage Manko Of Active J ○ Of The Same Year As My Daughter [cen]

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online