javcensored jav high vision censored slut




FC2ONEZEBODADNNGODCHRVLULUSSISBLKGMEMAWDNACRMVSDMEYDPPPDAVSAAPODKSBJSDABROYDGVH

2017-10-21
120 min

[PRED-025]The Temptation And Total Domain Of This Private Tutor And Her Lovely Thighs Moe Ona

  • moe ona censoredslutsingle workPREDpremiumelegancePRED-025PRED025pred00025
    • 2017-10-21
    120 min

    [MIAE-136]From Slow Hand Techniques To Amazing Ejaculations, A Full Erection Massage Parlor Yu Shinoda

  • shinoda yu censoredsluthandjobMIAEmoodyzdragon nishikawamoodyz acidMIAE-136MIAE136miae00136
    • 2017-10-21
    180 min

    [MIFD-017]The Reverse Threesome Genius! A Real Twin AV Debut Ran Inoue Suzu Inoue

  • ran inoue inoue tin censoredbeautiful girlslutMIFDmoodyzzampaMIFD-017MIFD017mifd00017
    • 2017-10-21
    119 min

    [PRED-024]A Temptation Splash Seminar The Man Squirting Handjob Female Teacher Mao Kurata

  • kurata mao censoredbig titsslutPREDpremiumupdatingPRED-024PRED024pred00024
    • 2017-10-20
    131 min

    [TBTB-095]わがままSっ娘中出し大好きパイパン美少女女子校生 永井みひな

  • azumihina nagai mihina censoredcreampieschoolgirlTBTBchouchihoukou chuuTBTB-095TBTB095h-840tbtb00095
    • 2017-10-20
    180 min

    [ABNOMAL-058]Fat-Assed Horny Wife is a Bimbo in a Miniskirt!

  • censoredbig titsslutABNOMALmaguro productsmaru akebonoamazon girl maguro productsABNOMAL-058ABNOMAL058h-455abnomal00058
    • 2017-10-20
    142 min

    [DIV-241]Binaural Dirty Talk Masturbation While Daydream Fantasizing About Sex

  • hasumi claire freedom censoredslutDIVoffice k smaboroshikodiva sDIV-241DIV241h-275div00241
    • 2017-10-20
    134 min

    [SRS-073]A Slut Documentary Hikari (Age 20) A Golf Instructor File.11 A Specialized Sexual Elite Stimulating Hard Sex That Pushes The Limits Of Public Order And Standards Of Decency

  • censoredamateurslutSRSprestigemichiru sanshiroto senkaSRS-073SRS073118srs00073
    • 2017-10-20
    130 min

    [ELEG-028]WifeLife Vol.028 Michiko Uchihara Was Born In Showa Year 31 And Now She's Going Cum Crazy She Was 60 Years Old At The Time Of Filming Her 3 Sizes From The Top To The Bottom Are 85/72/90 90

  • michiko uchihara censoredbig titsmature womanELEGsex agent daydreamersdont knoweleganteELEG-028ELEG028h-213eleg00028
    • 2017-10-20
    126 min

    [ARM-636]Garter Belt Wrapped Thighs x Thigh Fucking

  • riko mizusawa tamaki walnut censoredslutARMaroma planningdont knowaromaARM-636ARM636arm00636
    • 2017-10-19
    121 min

    [SDMU-716]An SOD Romance SECRET GAME The Cuckolded Maso Husband Is An Obedient Pet For His Wife Aki Sasaki

  • aki sasaki censoredslutsingle workSDMUsod createishikawa kinSDMU-716SDMU7161sdmu00716
    • 2017-10-19
    88 min

    [GS-146]Girls In Itty Bitty Miniskirts Pissing Outdoors In The City! When I Spotted Her I Didn't Know What To Do, But I Was Strangely Turned On. But When She Saw Me Watching Her She Was Clearly Embarrassed - And Horny! She Came Right At Me For Th

  • censoredslutGSsosoru garconjuria noGS-146GS1461gs00146
    • 2017-10-19
    169 min

    [NHDTB-050]"You Can Cum One More Time, Right？" Cowgirl Style! Backdoor Style! A Private Tutor Who Likes To Spin Her Ass Around While His Big Dick Is Inside Her Lures Him To Multiple Orgasms

  • censoredblowjobslutNHDTBnatural highgambler satoruNHDTB-050NHDTB0501nhdtb00050
    • 2017-10-16
    107 min

    [MXGS-997]Noka Sakino x Bondage Queen

  • sakino flower censoredslutsingle workMXGSmaxingdera 3MXGS-997MXGS997h-068mxgs00997
    • 2017-10-15
    95 min

    [VOSS-059]I Was Home Sick From School, But My Dad Didn't Know That, So He Brought A Pretty Housewife From The Neighborhood Home For Some Creampie Sex! While They Were Hanging Out Having Some Pillow Talk, My Mom Suddenly Came Home!! Dad Panicked A

  • yu kawakami morino morino censoredcreampiemature womanVOSSvenustamatsuka bingoVOSS-059VOSS059voss00059
    • 2017-10-14
    152 min

    [JUFD-811]I Want To Get Fucked By A Horny And Voluptuous Colossal Tits Slut Umi MItoma Nina Nishimura

  • umi mitsumata nina nishimura censoredbig titsslutJUFDfitchJUFD-811JUFD811jufd00811
    • 2017-10-13
    188 min

    [ABP-650]Airi Suzumura Lucky Slut 1 All The Most Erotic Things You Can Imagine Are Actually Happening!!

  • suzumura airi censoredanalsquirtingABPprestigecharlie nakataABP-650ABP650118abp00650
    • 2017-10-13
    150 min

    [SCOP-466]We Heard This Rumor That A High Class Japanese Slut Who Works At This European F*K Club Is Working In Nishi Azabu! The SCOOP Troops Are Paying Big Money To Go Undercover ! A Thorough Investigation To See How Far We Can Go At This High Class

  • censoredcreampiebig titsSCOPk m produceakai suiseiSCOP-466SCOP466h-565scop00466
    • 2017-10-11
    182 min

    [YTHY-004]Two Slut Goddesses Hey Dirty Old Man, Can We Stay Over Tonight!？ [Plain Jane Big Tits] Creampie Sex [A Sweet Girl In Glasses] Anri, Kanako

  • censoredcreampiebig titsYTHYtmayasutoki to hiroyukiYTHY-004YTHY00455ythy00004
    • 2017-10-08
    133 min

    [DOJU-090]"Why Are You Teasing An Old Lady Like Me？" This Hot Housewife Is Beautiful But Horny So We Took Her Home And Got Her Hooked On Infidelity Sex And Filmed Peeping Videos Of Her vol. 1

  • censoredcreampiemature womanDOJUjukujo japanDOJU-090DOJU090doju00090
    • 2017-10-08
    81 min

    [VENU-726]A Mother And Son Who Start Fucking 2 Seconds After Dad Leaves The House Satomi Suzuki

  • satomi suzuki censoredcreampiemature womanVENUvenuspe taVENU-726VENU726venu00726
    • 2017-10-08
    132 min

    [DOJU-091]"You Really Want To Fuck An Old Lady Like Me？" Video Of A Young Stud Taking A Completely Mature Cougar Back To His Place And Seducing Her Into Creampie Sex vol. 27

  • censoredcreampiemature womanDOJUjukujo japanDOJU-091DOJU091doju00091
    • 2017-10-08
    138 min

    [CEAD-242]I Had A Sister Sandwich With My Devoted Big Sister And Selfish Little Sister

  • kana morisawa kanako iioka yui hatano censoredcreampiemature womanCEADceleb no tomoupdatingCEAD-242CEAD242cead00242
    • 2017-10-08
    95 min

    [VEC-283]My Friend's Mother Ayako Inoue

  • ayako inoue censoredcreampiemature womanVECvenuskanieVEC-283VEC283vec00283
    • 2017-10-07
    119 min

    [CJOD-105]Unlimited Time! Unlimited Orgasms! Creampies & Dirty Talk at Upscale Soapland for Submissive Men Anna Morikawa

  • morikawa anna censoredcreampiebig titsCJODslut heavenzakku araiCJOD-105CJOD105cjod00105
    • 2017-10-07
    120 min

    [CJOD-108]Licked Up And Down Fellatio With Her Long Snake-Like Tongue And Get Swallowed Whole Sho Nishino

  • sho nishino censoredblowjobslutCJODslut heavenakai suiseiCJOD-108CJOD108cjod00108
    • 2017-10-07
    116 min

    [OBA-359]This Horny Mother Is In An Illicit Relationship With Her Son's Private Tutor Yoko Shirayama

  • yoko hakusan censoredmature womanslutOBAmadonnakogatake samuraiOBA-359OBA359oba00359
    • 2017-10-07
    120 min

    [CJOD-109]She'll Tease You With Her Tongue And Suck You Hard! A Beautiful Lady Who Loves To Suck Dick With Energy Draining Blowjob Technique Will Blow You Away Renon Kanae

  • kanae lennon censoredblowjobbeautiful girlCJODslut heavenakai suiseiCJOD-109CJOD109cjod00109
    • 2017-10-06
    120 min

    [YSN-467]I'm A Cherry Boy Who Is Obsessed With Cleanliness, And My Big Sister Looks Down On Me And My Smelly Cock, So One Day I Played Some Pranks On Her By Making Her Sniff My Cum I Thought She Would Get Mad, But It Flipped Her Eros Company Swit

  • nami sekine kimiiro kanon censoredblowjobslutYSNnonYSN-467YSN467h-127ysn00467
    • 2017-10-06
    61 min

    [WWK-024]Adultery x Utterly Charming x Sex Miho Tono

  • miho tsuno censoredblowjobslutWWKwaap entertainmentk westWWK-024WWK0242wwk00024
    • 2017-10-06
    123 min

    [DGRE-004]A Deep Throat Dick Sucking Specialist 003 Rino Kirishima

  • rino kirishima censoredblowjobslutDGREwaap entertainmentkindaichishougo rouDGRE-004DGRE0042dgre00004
    • 2017-10-06
    118 min

    [CMD-010]Tempting Hair Dresser Akari Maijima

  • akari maijima censoredblowjobslutCMDdream ticketupdatingCMD-010CMD01024cmd00010
    • 2017-10-01
    138 min

    [EKDV-502]I... Will Become A Slut! Miyu Saito A Slut Transformation Plan

  • miyu saito censoredcreampiebig titsEKDVcrystal eizowantoppuEKDV-502EKDV50249ekdv00502
    • 2017-10-01
    98 min

    [ANB-136]I Became my Mom's Sex Toy! Hot Mother-in-law's Big Tits Drives My Dick Wild! Saori Miyamoto

  • rio miyamoto censoredbig titsmature womanANBrubyyanoguchi susumuANB-136ANB136anb00136
    • 2017-10-01
    140 min

    [GAS-433]The Meister Teaches You How To Make Her Cum With Pleasure A Titty Fuck Slut

  • momomiya momo shizuka nonami censoredbig titsslutGAScinema unit gastakatsuki akiraGAS-433GAS43371gas00433
    • 2017-09-30
    155 min

    [BLK-332]He's Changed Ever Since His Cherry Boy Graduation! A Gal Style Cherry Popping Infinite Cum Shooting Confinement Creampie Fuck Fest Nao Wakana

  • nao wakana censoredcreampieslutBLKkira kirakira kira black galBLK-332BLK332blk00332
    • 2017-09-30
    160 min

    [MVSD-334]10 Thick And Gooey Cum Shots Welcome Here At The Cum Swallowing Soapland Mao Kurata

  • kurata mao censoredbig titsslutMVSDm s video groupzampaMVSD-334MVSD334mvsd00334
    • 2017-09-30
    119 min

    [PPPD-593]The Busty Teacher's Allure Shiori Kamisaki

  • shiori kamisaki censoredbig titsslutPPPDoppaiupdatingPPPD-593PPPD593pppd00593
    • 2017-09-30
    148 min

    [IPX-020]Erotic Nympho Nurses Love Getting Cum In Their Mouths Excessive And Stimulating! Violent Lustful NTR Techniques On Fire! Mitsuki Hoshikawa

  • mizuki hoshikawa censoredslutsingle workIPXidea pocketkyoseidishIPX-020IPX020ipx00020
    • 2017-09-30
    173 min

    [IPX-023]Supreme Butt Fetish Maniacs Exquisite Ass Nympho Teacher Version Himawari Yuzuki

  • sunflower sunflower censoredslutsingle workIPXidea pocketmasaki naoIPX-023IPX023ipx00023
    • 2017-09-30
    118 min

    [IPX-022]A Bushy Pussy Haired Crazy Cowgirl Fuck The Temptation Of Happy Ejaculation! High Speed Pussy Pounding Slut Fuck Dance! Kana Momonogi

  • kana momonogi censoredsquirtingbeautiful girlIPXidea pocketzampadishIPX-022IPX022ipx00022
    • 2017-09-23
    117 min

    [WANZ-662]Girl Bullies Piledriving Cowgirl Creampie - Minori Kawana

  • real village henan censoredcreampieschoolgirlWANZwanz factoryupdatingWANZ-662WANZ662wanz00662
    • 2017-09-23
    155 min

    [JUFD-798]Tantalizing Working Women Fully Clothed Fuck - Ria Kashii

  • ria kashii censoredbig titsslutJUFDfitchtaishi douJUFD-798JUFD798jufd00798
    • 2017-09-23
    119 min

    [WANZ-664]Make you Cum in Seconds! Yuu's Bewitching Blowjob Tech - Yuu Asakura

  • yu asakura censoredblowjobslutWANZwanz factorywanzWANZ-664WANZ664wanz00664
    • 2017-09-23
    116 min

    [MIAE-118]My Cowgirl Will Make You Cum - Nao Wakana

  • nao wakana censoredbig titsslutMIAEmoodyzupdatingMIAE-118MIAE118miae00118
    • 2017-09-23
    119 min

    [PRED-015]Suck! Slurp! Her Lips Just Love To Suck Dick Aika Yamagishi

  • aika yamagishi censoredblowjobslutPREDpremiumsuisei akaielegancePRED-015PRED015pred00015



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online