javcensored squirting amateur female college student censored




FC2SHKDCAWDDASDPPPDVENUIPXNATRSPRDADNWAAAHNDSSNIMVSDMILKSDABKBIMIAAEBODNGODGVH

2020-12-27
254 min

[SIGL-001]Amateur Girls Vol. 1: 3 Horny Amateur Girls Getting Raw Creampies

  • censoredcreampiebig titsSIGLshirotogaru mousouzokushiroto guardsSIGL-001SIGL001sigl00001
    • 2021-01-04
    158 min

    [C-2608]Housewives' Adultery Trips #194

  • censoredCgo go zutakahashi kouichigogos coreC-2608C2608140c02608
    • 2021-01-07
    17 min

    FC2PPV 1635625 1800pt → 900pt [Gonzo] A married woman in an affair blames M man who is a thick stranger stick and makes it splash

  • amateur uncensoredfc2
    • 2021-01-07
    43 min

    Pacopacomama 010721_415 Yui Minami, Kanae Koizumi, Sumire Maeda

  • yui minami kanae koizumi uncensoredblowjobslutpacopacomama
    • 2021-01-15
    86 min

    300MAAN-617 [G cup god style hostess and Kabukicho party sex! !! ] The best beauty with the best characters and glue that you absolutely want to nominate participates in the guarantee drinking! Big breasts x constriction x beautiful legs, a super bea

  • amateur censoredcreampiebig titsmaanmaan-617maan617300maan-617
    • 2021-01-16
    118 min

    [MVSD-452]Dual Curvaceous Devils - Twin Sluts With Huge Tits Lavish Your Dick With Attention - A Succubi Sandwich

  • yukino nagi nene tanaka censoredcreampiebig titsMVSDm s video groupMVSD-452MVSD452mvsd00452
    • 2021-01-23
    50 min

    450OSST-008 A mysterious girlfriend who reads in the rain found in Korea, has a visual that is as good as an idol and a transcendental constriction! Defeat Saddle with shame play while sniffing the panties that you took off!

  • amateur censoredamateurosstosst-008osst008450osst-008
    • 2021-01-23
    119 min

    [CAWD-174]It's Been Three Months Since Her Debut & First Creampie And She Can't Forget That Feeling... So She's Ready To Cum To The Capital For Another Film! She Wants To Open New Doors! She Wants To Fuck Harder! She Wants To Try Subbi

  • white peach censoreddeepthroatsingle workCAWDkawaiitiger kosakaiCAWD-174CAWD174cawd00174
    • 2021-01-24
    127 min

    [GENM-070]The Sequel: Breaking In A Trapped Babe At An Outdoor Warehouse Caught On Camera Rika Tsubaki

  • tsubaki rika censoredbig titssingle workGENMgenekig 3GENM-070GENM070genm00070
    • 2021-01-24
    161 min

    [CESD-970]Pet You 4 Momo Kato ka

  • kato momoka censoredcreampiemature womanCESDceleb no tomoCESD-970CESD970cesd00970
    • 2021-01-30
    148 min

    [MIMK-083]Cuckolding A Wife Next Door With Aphrodisiacs: The First Collaboration Between Popular Manga Artist Ishito Yura And MOODYZ! Haru Kawamura

  • kawamura haru censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-083MIMK083mimk00083
    • 2021-02-02
    49 min

    H4610 ki210202 Emi Hasegawa 21years old

  • amateur uncensoredh4610
    • 2021-02-02
    124 min

    [ARM-949]My Cousin's Grown Into A Smoking Hot Slut？! Coating Her Lower Half In Cum While She's Still Wearing Her Panties Tsukino Okawa

  • okawa tsukino censoredsingle workARMaroma planninghamu oujiaromaARM-949ARM949arm00949
    • 2021-02-04
    60 min

    [loli-033]ひかる

  • amateur censoredcreampieschoolgirlloliloli-033loli033loli-033
    • 2021-02-10
    45 min

    FC2PPV 1680601 ☆ First shot ☆ Complete appearance ☆ Fair-skinned plump G body obedient G cup beautiful girl who looks good with shortcuts is the first Gonzo and cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-25
    167 min

    [NHDTB-494]These 2 Voluptuous Slut Babes Are Wearing Tight Knit Dresses And Hemming Me In With Their Big Asses, And When I Got n Erection, They Ejaculated Me With A Smile

  • censoredslutNHDTBnatural highlemonheart nakajimaNHDTB-494NHDTB4941nhdtb00494
    • 2021-03-06
    118 min

    [ADN-302]"Hey... We Can Still Do It, Right？" Nailing Your Gorgeous, Dedicated Boss From Dusk Until Dawn. Tsumugi Akari

  • akari tsumugi censoredslutsingle workADNattackerskazumaotona no dramaADN-302ADN302adn00302
    • 2021-03-13
    48 min

    H0930 ki210314 Takami Ooshiro 30years old

  • amateur uncensoredh0930
    • 2021-03-18
    118 min

    [PPPD-914]Making Babies Out Of Wedlock With Your Colossal-Titted I-Cup Lover Who Comes Hard For Your Creampie At A Hot Spring Hotel

  • censoredcreampiebig titsPPPDoppaiPPPD-914PPPD914pppd00914
    • 2021-03-19
    63 min

    [sika-053]みか(18)

  • amateur censoredschoolgirlamateursikasika-053sika053sika-053
    • 2021-03-26
    55 min

    [pvmk-009]まこ(23)

  • amateur censoredamateurpvmkpvmk-009pvmk009pvmk-009
    • 2021-04-02
    42 min

    FC2PPV 1752148 * Urgent sale * [No] [Appearance] [Personal shooting] [4K review privilege] [Early end] Exclusive 〇 〇 Outflow just before debut ☆ Beautiful girl 3P orgy creampie

  • amateur uncensoredfc2
    • 2021-04-03
    82 min

    C0930 ki210404 Kyouko Ishinuki 27years old

  • amateur uncensoredc0930
    • 2021-04-15
    153 min

    [MMKZ-094]A Cute Face And A Huge Ass!! Sarina Kurokawa

  • sarina kurokawa censoredsingle workMMKZmarrionkojiro miyamotoirisMMKZ-094MMKZ094mmkz00094
    • 2021-04-16
    109 min

    [MXGS-1180]Immediately Fucking Ten Hasumi, A Delicate Bright Girl Who Doesn't Have A Clue

  • hasumiten censoredbeautiful girlsingle workMXGSmaxingMXGS-1180MXGS1180h-068mxgs01180
    • 2021-04-17
    119 min

    [JUL-550]I Work For A Housecleaning Service, And I Was Sent To The Home Of The Worst Bad Boy In The Neighborhood. Marika Kobayashi

  • marika kobayashi censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-550JUL550jul00550
    • 2021-04-20
    54 min

    492JCHA-005 JK Fresh Erotic Oil Massa Treatment 2

  • amateur censoreduniformschoolgirljchajcha-005jcha005492jcha-005
    • 2021-04-22
    115 min

    [CHERD-075]"Would You Mind Your First Time Being Raw Sex With An Older Woman？" Virgin Pops His Cherry In The Best Way With A Hot Married Cougar Yumie Kashihara

  • tomie kashihara censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-075CHERD075h-086cherd00075
    • 2021-06-01
    38 min

    475SKCK-035 Himena 3

  • amateur censoredanalamateurskckskck-035skck035475skck-035
    • 2021-06-26
    151 min

    [LULU-077]Her Husband Was Out, So It Was Just The Two Of Us - I Couldn't Resist My Step-Aunt's Big Booty While She Was Cleaning, And Ended Up Pounding It Right To A Creampie. Ai Mukai

  • ai mukai censoredcreampiesingle workLULUlunaticsluminaxLULU-077LULU077lulu00077
    • 2021-07-07
    80 min

    259LUXU-1431 Luxury TV 1427 Former Race Queen Slender Wife Appears In AV For Stimulation! Obscene sexual intercourse that makes a horny sound from an oil-covered obscene body and cums! !!

  • amateur censoredmarried womanamateurluxuluxu-1431luxu1431259luxu-1431
    • 2021-07-14
    47 min

    FC2PPV 1922123 [No] [Limited To 100 Pieces 2980 → Off To 1480pt!] A Beautiful Cosmetologist Working At A Department Store ♥ ️ Even Though She Is Cool, She Has Sex! A Large Amount Of Vaginal Cum Shot! !! ♥ ️ * Review Benefits / High Quality Ver

  • amateur uncensoredfc2
    • 2021-07-22
    124 min

    [NHDTB-558]I Met This Slut At The Men's Bath 5 She Suddenly Gave Me A French Kiss And Held Me Tight And Fucked Me And I Could No Longer Resist, So I Came Inside Her Pussy, Over And Over Again

  • censoredcreampiebig titsNHDTBnatural highbacon tanakaNHDTB-558NHDTB5581nhdtb00558
    • 2021-07-30
    239 min

    [HUNTB-072]"I want to see how big your penis gets!" My cute step-niece is a horny girl! She licks her step-uncle"s nipples and gives him a boner! Her body isn"t fully mature yet though...

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-072HUNTB072huntb00072
    • 2021-07-30
    118 min

    [SSIS-134]I Thought My Girlfriend Hated Her Manager But She Loves Getting Fucked By His Dick - Yumi Shion

  • evening beauty censoredbig titsdeepthroatSSISs1 no 1 stylekitorune kawaguchiSSIS-134SSIS134ssis00134
    • 2021-08-31
    120 min

    [SAN-015]Wife Cuckolded By Best Friend Who Took Care Of Her Debts Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workSANmazakisakura kabinmother mazaSAN-015SAN015h-796san00015
    • 2021-09-02
    125 min

    [AARM-013]Making Him Come While Passionately Kissing Him And Playing With His Nipples And Dick

  • mizuki yayoi okawa tsukino censoredsluthandjobAARMaroma kikakusatoshimaniaaromaAARM-013AARM013aarm00013
    • 2021-09-04
    54 min

    H0930 ori1611 Yui Higa 30years old

  • amateur uncensoredh0930
    • 2021-09-05
    35 min

    FC2PPV 2151561 [No Right] Namba High-Priced Assistance ⑬ * Succeeded In Local Mobile Shooting! (It Will Be 3900 After 3400 Until September 20th)

  • amateur uncensoredfc2
    • 2021-09-15
    69 min

    FC2PPV 2207180 "By All Means, Only The Face …" The 18-Year-Old Slender Beauty Student Of 155 Cm Hides Her Face And Does Not Hide Her Pussy!

  • amateur uncensoredfc2
    • 2021-09-17
    160 min

    [MIDE-971]A Super Lewd Girl Speaking A Dialect Gets You Off: Prostitution Residence - Kibo Ishihara

  • ishihara hope censoredcreampiebig titsMIDEmoodyztorendei yamaguchimoodyz divaMIDE-971MIDE971mide00971
    • 2021-09-19
    27 min

    FC2PPV 2224133 Face / No ◯ Positive [Cuckold J ◯ Mami-Chan Series 2nd] Boyfriend I’M Sorry Again ★ Ntr ★ Mini Egg Girls Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-06
    57 min

    541AKYB-009 Mika (20) Yurufuwa G Cup Girl ♪ (Nazuna Nonohara)

  • amateur censoredbig titssquirtingakybakyb-009akyb009541akyb-009
    • 2021-10-08
    37 min

    [tyvm-198]ゆかり(38)

  • amateur censoredcreampieamateurtyvmtyvm-198tyvm198tyvm-198
    • 2021-10-09
    151 min

    [SCOP-741]The Life Insurance Lady Who Came To Do Business With Us Was Surprisingly Bra-less And Panty-less! I Was Going To Turn Her Down 120 Of The Time, But My Virgin Dick Got So Stiff I Couldn"t Hold Back And I Had To Have Sex With Her On The S

  • censoredcreampiebig titsSCOPk m producek tarouscoop kmpSCOP-741SCOP741scop00741



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online