mature woman dmm exclusive javcensored jav incest




FC2CJODAUKSWANZNNPJWAAAPPPDNACXEBODMVSDVENUNATRMILKVEMADASDSPRDMARASANFSDSSVENXKSBJ

2020-10-30
65 min

328HMDN-307 [♀ Personal shooting] Unauthorized rubber removal SEX at the age of 18 ♪ “Why is it so good？” While feeling something strange with a sensitive pussy, it feels too good and my head is pure white! A large amount of vaginal cum sho

  • amateur censoredcreampieschoolgirlhmdnhmdn-307hmdn307328hmdn-307
    • 2020-11-05
    92 min

    [hoi-141]ゆうかさん(27)

  • amateur censoredbig titsamateurhoihoi-141hoi141hoi-141
    • 2020-11-06
    78 min

    259LUXU-1324 Luxury TV 1323 A beautiful tutor with adorable looks and overwhelming presence of G-cup big tits appears again! Show off masturbation with a gentle but unwilling hand … The body lit by masturbation reacts sensitively just by caressi

  • amateur censoredbig titsamateurluxuluxu-1324luxu1324259luxu-1324
    • 2020-11-19
    118 min

    [SSNI-908]Detective Hotaru Goes Undercover At A Night Club And Ends Up G*******ged Hotaru Nogi

  • nogi firefly censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-908SSNI908ssni00908
    • 2020-11-21

    FC2PPV 1579080 Limited number [None] Continuous vaginal cum shot to sensitive CA (69 minutes)

  • amateur uncensoredfc2
    • 2020-12-12
    119 min

    [IPX-577]5ƍ" G-Cup With An Incredible Body Can Make You Cum Without Lifting A Finger Kanon Yano

  • kanon yano censoredbig titsslutIPXidea pocketkyoseidishIPX-577IPX577ipx00577
    • 2020-12-20
    96 min

    [KIR-023]"It's Not Like I'm Trying To Seduce You. I'm Dressed Like This Because The AC's Broken" Apartment Wife Makes Men Hard In Spite Of Their Better Judgment Manami Oura

  • manami oura censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-023KIR023h-254kir00023
    • 2021-01-05
    14 min

    FC2PPV 1633399 Limited to 2 days [Individual] Not enough interest … Wife taken by car and vaginal cum shot in throat and vagina

  • amateur uncensoredfc2
    • 2021-01-20
    22 min

    FC2PPV 1652349 [Personal shooting] Affair with a young slender married woman. Insert the underwear from the side of the pants and make vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-01-20
    119 min

    [TENX-18112]Mature Woman Posted: 40-Something Lovers

  • censoredmarried womanamateurTENXtennin xtaro tsuboTENX-18112TENX18112h-1542tenx18112
    • 2021-01-24
    100 min

    [SRMC-028]Sensual Approach Of A Big Butted Wife Reiko Kobayakawa

  • kobayakawa reiko censoredslutsingle workSRMCh m rashmiyoshi rusherSRMC-028SRMC028srmc00028
    • 2021-01-25
    51 min

    FC2PPV 1641843 [Limited quantity 2980pt → 1980pt] Obedient bitch pet training for active beauty member Yuko ❤️ A perverted woman who turns into a bitch’s face from the moment she wears a ball gag and a collar ❤️ Plenty of semen injection with sq

  • amateur uncensoredfc2
    • 2021-01-27
    122 min

    496SKIV-002 Yuki who loves cum 2

  • amateur censoredamateurskivskiv-002skiv002496skiv-002
    • 2021-02-05
    71 min

    300NTK-513 SEX apt! !! A beautiful gamer with a tall F cup! !! Even if you lose the punishment game, you can win at the woman on top posture! !! Two shots of continuous vaginal cum shot with E-sports sex of lack of exercise & libido elimination o

  • cmfjd censoredcreampieamateurntkntk-513ntk513300ntk-513
    • 2021-03-01
    48 min

    FC2PPV 1706939 Infiltrate a woman’s house ★ 19-year-old neighborhood college student who matched with Tinder wants to be 〇 by a stranger Big tits metamorphosis beauty ★ First time limited unauthorized vaginal cum shot SEX video [37 minutes] 1 gi

  • amateur uncensoredfc2
    • 2021-03-13
    179 min

    [EBOD-809]She's A Handjob Goddess Who Can Ruin Men With Her Hands! This Beautiful Big Tits Massage Parlor Therapist Calls Herself The Destroyer Of Men And Is Now Making Her Adult Video Debut Leona Fujisaki

  • leona fujisaki censoredbig titshandjobEBODe bodykyoseiEBOD-809EBOD809ebod00809
    • 2021-03-18
    120 min

    [SSIS-017]You Woke Up After A Wild Party With The Hot J-Cup Boss You've Always Wanted. The Two Of You Have Your Own Afterparty - Naked - Together Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylerokusaburo mishimaSSIS-017SSIS017ssis00017
    • 2021-03-19
    181 min

    [DOCP-282]"Please Pump Me More With Your Cock!! Please!!" A Naughty And Haughty, Highly Conscious Girl Gets Slathered With Aphrodisiacs And Becomes Super Horny!! She's Shaking her Big Ass And Begging To Be Fucked! Pride-Shattering, Furiou

  • emily hikari sakuraba sawa lemo censoredcreampieDOCPprestigedoc premiumDOCP-282DOCP282118docp00282
    • 2021-03-21
    120 min

    [JUL-507]The Story Of How I Spent Three Days Lovingly Fucking My Now Married Former Classmate When Visiting My Hometown Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanJULmadonnajo asagiriJUL-507JUL507jul00507
    • 2021-03-26
    153 min

    [JUFE-274]Himari-chan ...Thank You For Making Me Feel Better With Sex After My Girlfriend Dumped Me Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieslutJUFEfitchsamoariJUFE-274JUFE274jufe00274
    • 2021-03-29
    67 min

    491TKWA-075 Pink Pocchi Nipple Neat Slender Girl And Uniform Again Rich SEX

  • amateur censoreduniformamateurtkwatkwa-075tkwa075491tkwa-075
    • 2021-04-03
    59 min

    383REIW-052 Natsuki

  • amateur censoredbig titsamateurreiwreiw-052reiw052383reiw-052
    • 2021-04-03
    120 min

    [NASH-484]Wives Who Cheat With Their Fathers-In-Law - Sexless Marriages Lead To Moaning Sluts! At-Home Adultery

  • censoredcreampiemarried womanNASHpinknadeshikoNASH-484NASH484nash00484
    • 2021-04-08
    127 min

    [GUN-852]Cougar In A Sailor Uniform's Incontinence Shame Waka Ninomiya

  • waka ninomiya censoredmature womanGUNradixsakuraba nine heart manpreeminentGUN-852GUN852433gun00852
    • 2021-04-17
    119 min

    [NNPJ-444]Picking Up Girls On Christmas Day - These Lonely Sluts Are Desperate For Touch - This Married Woman Just Wants To Feel Like A Female Again - A Night Of Horny, Red-B***ded Passions. Housewife With A Family, Ms Seiko (Age 35) NANPA

  • censoredcreampieamateurNNPJnanpa japanNNPJ-444NNPJ444nnpj00444
    • 2021-04-27
    241 min

    [SDJS-117]Mother's Day Special Variety Show! Showing Our Appreciation For Our Very Own Working Moms! SOD's Got 10 Female Employees Who Juggle Motherhood With Work, And We're Ready To Give Them The Orgasms They Deserve! Medical Exam With S

  • rie hanai chika kaneko censoredmarried womansquirtingSDJSsod createdynanasod female employeeSDJS-117SDJS1171sdjs00117
    • 2021-04-30
    47 min

    FC2PPV 1795998 I was bullied by Lori’s face and tried to fuck

  • amateur uncensoredfc2
    • 2021-06-10
    127 min

    [IESP-681]Ren Usui Lesbian Unleashed: My Stepsister Fell In Love With Me

  • usui ren kiriyama yuu censoredbig titslesbianIESPienergykikuriniespIESP-681IESP6811iesp00681
    • 2021-06-19
    115 min

    [CAWD-235]While My Girlfriend Was Away On A Training Seminar, I Spent The Next 3 Days With My First Love, An Ex-Girlfriend Whom I Could Never Forget, And We Fucked Like Crazy Yuika Aoi

  • yuka aoi censoredsingle workdramaCAWDkawaiitake dCAWD-235CAWD235cawd00235
    • 2021-06-26
    110 min

    390JAC-093 [Ultimate De M x Self Irama x Peeing Ma ● Ko] Kick Prodigy Appears Here! !! Bumpy a man with his favorite kicks and punches! !! Offense and defense change when SEX starts! !! Irama blames the upper throat! Serious slap TKO! Peeing outside

  • maxm censoredcreampiesquirtingjacjac-093jac093390jac-093
    • 2021-07-24
    47 min

    H4610 ki210725 Kayoko Yuge 31years old

  • amateur uncensoredh4610
    • 2021-08-14
    51 min

    404DBL-0083 Rainy Day Mature Woman 3P! Shoko 47 Years Old & Akemi 52 Years Old

  • amateur censoredcreampiebig titsdbldbl-0083dbl0083404dbl-0083
    • 2021-08-21
    240 min

    [OKAX-767]Penis Addiction 2: The Girl Who Loves Hard Cocks And Gets Wet From Giving Head

  • rin kuramochi sakura mochizuki riko nanami censoredblowjobslutOKAXk m produceokazuOKAX-767OKAX767okax00767
    • 2021-09-05
    106 min

    [LOL-199]Y********l Specialty. Rough Sex From Step-father During Hellish Hot Springs Vacation With Masochistic Girl. Ten Hasumi

  • hasumiten censoredcreampiebeautiful girlLOLglayzrori senkaLOL-199LOL19912lol00199
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-10-01
    93 min

    380SQB-121 Tin (Monami Suzu)

  • amateur censoredcreampieamateursqbsqb-121sqb121380sqb-121
    • 2021-10-02
    77 min

    533NNS-019 Explosion H Cup P Live Girl! !! Unauthorized Mass Vaginal Cum Shot To A Big Tits De M Daughter Who Works At A Famous Hotel! !!

  • amateur censoredcreampiebig titsnnsnns-019nns019533nns-019
    • 2021-10-08
    145 min

    [IPX-735]A New Female Employee Is Made To Cum Over And Over Again By Her Adulterous Boss In A Shared Room NTR At A Business Trip. Kotoyumi Ono

  • kotoyumi ono censoredblowjobsingle workIPXidea pocketmaeda bungoutissueIPX-735IPX735ipx00735
    • 2021-10-16
    89 min

    300MAAN-707 [Must Fall In Love! !! Geki Kawa Nice Bottom Concafe Clerk] 100 Points Of Erotic Cuteness With A Sense Of Distance That Captivates A Man And Cute Gestures! !! Completely REC The Whole Story That Nozomi Who Likes To Blame With A Cute Face

  • amateur censoredamateurcosplaymaanmaan-707maan707300maan-707
    • 2021-10-20
    89 min

    [VNDS-3377]An Old Man (A 35-Year Old Unemployed Stepson) Who Lives In A Little Boy"s Room Gets Sexual Satisfaction With His Stepmom Saryu Usui

  • sakisui censoredcreampieblowjobVNDSstar paradisenext11VNDS-3377VNDS3377h-254vnds03377
    • 2021-11-05
    160 min

    [DVDMS-732]A Normal Boys And Girls Focus Group Adult Video x The Magic Mirror Number Bus Collaboration Variety Special An Elegant Sales Lady From The Beauty Section Of A First Class Department Store Is Getting A Big Dick Plunged Into Her Pussy After

  • censoredsquirtingamateurDVDMSdeepspoolsideDVDMS-732DVDMS732dvdms00732
    • 2021-11-06
    100 min

    [NKHB-011]Discovery. Natural Airhead J-Cup Chubby Amateur. Desires Anonymity

  • censoredbig titsamateurNKHBnikuatsu shokudou mousozokuNKHB-011NKHB011nkhb00011
    • 2021-12-03
    300 min

    [DVDMS-743]Face Reveal MM Model - College Girl Exclusive The Magic Mirror. Real Friend Groups With Guys And Girls From College Enjoy Amateur Sex For The First Time! Just 2 People In A Locked Room While Rubbing A Clit And Dick Together, Will They Beco

  • censoredcreampieamateurDVDMSdeepsking of genkingthe magic mirrorDVDMS-743DVDMS743dvdms00743
    • 2021-12-10
    115 min

    [IPX-773]Love Under the Shade. Lonely S*****t and Teacher Seek Out Each Other For Forbidden Deep-Toungued Kisses And Intercourse.

  • futaba emma censoredschoolgirlblowjobIPXidea pocketdishIPX-773IPX773ipx00773
    • 2022-01-15
    80 min

    200GANA-2639 Seriously Nampa, First Shot. 1744 Picking Up A Busty Jd At The End Of Class And Bringing It To The Hotel! Pure White Beauty Body, Slippery Pie Bread Beauty Ma ● Ko Mochi Mochi Prickets! The Perfect Body Of Impeccable Pear Is Ridiculously

  • amateur censoredbig titsamateurganagana-2639gana2639200gana-2639
    • 2022-01-20
    123 min

    [JURA-047]First Time Shots, 60 Year Old Wife, Again. Asami Kudo

  • kudo asami censoredcreampiemarried womanJURAcenter villagejiro fukagawajurakuJURA-047JURA047h-086jura00047



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online