miku ohashi




FC2STARSHZGDMEYDCHRVSSNIPREDADNHDKAWAAASPRDHODVHNDROYDAVSANNPJGMEMCESDSQTESANIPX

2020-12-18
135 min

[MMYM-041]This Fine Woman Stared At Me With A Tempting Gaze And Hit Me With A Steady Stream Of Ass-Shaking Filthy Dirty Talk Nanami Matsumoto

  • nana matsumoto censoredbig titsslutMMYMmarrionaida yumenoyumenoMMYM-041MMYM041mmym00041
    • 2021-01-01
    790 min

    [LONG-020](For Streaming Editions) A Super Turn Of Events Underneath The Foot Warmer A Beautiful Girl Has Her Guard Down And Is Ready For Deep And Rich Sex!! Super Long-Length 13 Hours!!

  • censoredcreampieamateurLONGprestigelongshotLONG-020LONG020118long00020
    • 2021-01-08
    243 min

    [MGT-131]Pickin Up Amateur Girls On The Street! Vol. 98 - Poolside Pickups 2020 1

  • censoredsquirtingamateurMGTprestigemegatraMGT-131MGT131118mgt00131
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-31
    161 min

    [VEO-037]Real Married Amateur's Porn Debut! From The Outside Looking In, It Seems Like Her Marriage Is Great... But Her Husband Isn't Satisfying Her In The Bedroom (One Quarter Scandinavian Model From Kyoto) Determined To Cum For Three Full F

  • karen ogawa censoredcreampiemature womanVEOvenusbingo tamatsukabornVEO-037VEO037veo00037
    • 2021-02-05
    73 min

    HEYZO 2485 Requesting The POV Fuck Option -Shinagawa- – Kira

  • kira uncensoredheyzo
    • 2021-02-06
    118 min

    [ADN-291]Sweaty Fucking All Over In The Daytime With A Sexually Frustrated Married Woman. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersnaotootona no dramaADN-291ADN291adn00291
    • 2021-02-07
    239 min

    [YLWN-153]Horny Mature Nurses At A General Hospital! If You Hit On Them, Will They Fuck You？

  • censoreduniformmature womanYLWNyellow moonpappan tateishiYLWN-153YLWN153ylwn00153
    • 2021-02-10
    31 min

    FC2PPV 1680076 [With bonus video] Youkai fuck “Miss luxury soap” or “Black pussy returns” [No]

  • amateur uncensoredfc2
    • 2021-02-11
    124 min

    [NSM-028]An Aphrodisiac Oil Massage Peeping & Creampie Fucking With Amateur Girls VOL.28 We Used This Compound Of Super Powerful Aphrodisiacs Mixed Into Massage Oil And Used It On These Unsuspecting Ladies, And They Were Surprised To Find Their Bo

  • gloss hall shiori endo bookmark satoshi yamaguchi censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-028NSM028h-1342nsm00028
    • 2021-02-12
    119 min

    [JUFE-257]Dense Licking Sexual Intercourse, Dripping Juices While Staring At A Man - Karen Usui

  • usui ren censoredsquirtingblowjobJUFEfitchJUFE-257JUFE257jufe00257
    • 2021-02-12
    115 min

    [PARATHD-3101]Picking Up Shinjuku Amateurs "Please Show Us Your Tits!" Special Edition Part 4 - Miori Hara

  • miori hara censoredbig titsamateurPARATHDparadise tvPARATHD-3101PARATHD3101parathd03101
    • 2021-02-17
    75 min

    [sika-043]16番みーちゃん(18)

  • amateur censoredcreampieuniformsikasika-043sika043sika-043
    • 2021-02-17
    71 min

    [sika-035]りお(18)

  • amateur censoredcreampieschoolgirlsikasika-035sika035sika-035
    • 2021-02-18
    240 min

    [HUNTA-953]"Are You Really Sure You Won't Regret Having Sex For The First Time With An Old Lady Like Me？" I Was A Cherry Boy, But When I Got My Cherry Popped, It Was With My Young And Pretty, Super Nice Big Tits Stepmom ... And That's

  • censoredcreampieblowjobHUNTAhuntervolvo nakanohhh groupHUNTA-953HUNTA953hunta00953
    • 2021-02-22
    178 min

    [WNSK-002]After This, Will She Immediately Commit Infidelity!？ When I Saw My Girlfriend Defiled With Another Man's Semen, I Had A Melancholic Erection!!

  • censoredWNSKoneWNSK-002WNSK002wnsk00002
    • 2021-03-06
    53 min

    H0930 ki210306 Requested work

  • amateur uncensoredh0930
    • 2021-03-06
    40 min

    H4610 ki210307 Yuri Kondou 21years old

  • amateur uncensoredh4610
    • 2021-03-21
    135 min

    [JUL-514]Our Adultery Started With A Fateful Encounter, The Kind You See In Those Romantic Dramas On Mondays At 9 But When She Found Out That I Was A Premature Ejaculator, She Made Me Creampie Cum Over And Over Again Like A Sad Loser. Honoka Kimura

  • honoka kimura censoredcreampiemature womanJULmadonnaunicorn fukudaJUL-514JUL514jul00514
    • 2021-03-27
    47 min

    491TKWA-064 Noh weather kid minimum female college student wears glasses and transforms into an adult atmosphere! Once again, a ugly man’s raw chin is allowed to be inserted and a large amount of vaginal cum shot is made!

  • amateur censoredcreampieamateurtkwatkwa-064tkwa064491tkwa-064
    • 2021-03-29
    89 min

    511SDK-004 Lewd Affair Young Wife And Raw Saddle 2 Barrage! !! Gonzo on an affair date! Amateur married woman

  • amateur censoredbig titsmarried womansdksdk-004sdk004511sdk-004
    • 2021-03-31
    56 min

    FC2PPV 1749306 [Complete amateur 106] Faint 20 years old Part 3, complete appearance, private style vaginal cum shot sex with plain clothes

  • amateur uncensoredfc2
    • 2021-03-31
    58 min

    292MY-453 Honda Minami

  • amateur censoredmarried womanamateurmymy-453my453292my-453
    • 2021-04-09
    42 min

    FC2PPV 1760598 Enjoy with the slender 19-year-old for the first time. Sperm goes inside without vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-22
    124 min

    [HAVD-1007]The Kissing Lesbian Series, Drenched In Adult, Rich And Thick Drool This Horny Babe is Flipping Her Lust To Max Levels And Jumping Head First Into Horny Lesbian Sex!

  • maki kyoko yumina hirosaki censoredlesbianHAVDhibinodr torihamaHAVD-1007HAVD10071havd01007
    • 2021-05-22
    27 min

    FC2PPV 1830758 F cup wife who grasped the weakness. He is vaginal cum shot by a young man. [Uncensored, 500PT only on weekends]

  • amateur uncensoredfc2
    • 2021-06-11
    120 min

    [MEYD-681]If You Cannot Pay Your Rent, Should We Ask Your Wife To Pay With Her Body Instead？ Haha Kanna Hirai

  • shiori hirai censoredsingle workdramaMEYDtameike gororyo inugamiMEYD-681MEYD681meyd00681
    • 2021-06-25
    47 min

    FC2PPV 1886293 [No] [Complete appearance] 22-year-old Faculty of Law Ai-chan Appearance that violates the law for money Conceived by a beautiful law student and vaginal cum shot [* Blow (mouth ejaculation) & undressing / shower hidden shooting ben

  • amateur uncensoredfc2
    • 2021-06-25
    150 min

    [WAAA-075]Even After Cumming And Cleaning The Cum Off, I'll Keep Giving You A Sucking!! Tsubomi

  • bud censoredcreampieblowjobWAAAwanz factorywanzWAAA-075WAAA075waaa00075
    • 2021-07-01
    98 min

    [MESU-085]Creampie At The Office During Overtime Sex With My Older Female Superior - Misako Kiyohara

  • kiyohara misako censoredcreampiemature womanMESUcenter villagekotaro misatored snowMESU-085MESU085h-086mesu00085
    • 2021-07-09
    58 min

    383REIW-080 Naki

  • amateur censoredamateurbeautiful girlreiwreiw-080reiw080383reiw-080
    • 2021-07-17
    171 min

    [CAWD-252]She Awakened To Sexual Pleasures And Took To It Like A Sponge To Water! A Sexual First-Timer, Filled With Innocence Ren Midoriya x An Amazingly Skilled Adult Video Actor An Orgasmic Documentary, Filled With Her First Experiences With Sexual

  • midoriya ren censoredsquirtingsingle workCAWDkawaiiinaballCAWD-252CAWD252cawd00252
    • 2021-07-18
    103 min

    [NSFS-012]The Father-in-Law Who Engaged In A Pregnancy Fetish With His Daughter-in-Law On A Family Trip. Hana Himesaki.

  • himesaki hana censoredbig titssingle workNSFSnagae stylejotaro tomiNSFS-012NSFS012nsfs00012
    • 2021-07-20
    120 min

    [VNDS-7087]An Erotic Wife's Nasty Blowjob And Oral Creampie

  • censoredblowjobVNDSstar paradisenext toilet r eVNDS-7087VNDS7087h-254vnds07087
    • 2021-07-21
    30 min

    FC2PPV 1933207 * Service Price (Until 25th) [Uncensored] Umeda Cafe Clerk_i Gave A Lot Of Support To My Daughter Who Had Fewer Shifts At Corona.

  • amateur uncensoredfc2
    • 2021-07-23
    124 min

    [NCYF-012]Seven People In A Wild Orgy: Otherworldly Petite Fairy Cosplayer With A 140 cm Tall Body Has Her Innocent Tight Pussy Destroyed By Thick Rods. "Shaved Pussy Breaching With Spraying Squirt", "Mixed Cum Pregnancy Experiment",

  • censoredcreampiesquirtingNCYFall japan amateur photographers union daudagawaNCYF-012NCYF012ncyf00012
    • 2021-08-06
    152 min

    [MIAA-489]My Stepsister Who Put All Her Stat Points Into Her Face And Ass Makes Me Come Again And Again... Ichika Matsumoto

  • ichika matsumoto censoredcreampieslutMIAAmoodyzichinose kurumiminna no kikatanMIAA-489MIAA489miaa00489
    • 2021-08-10
    60 min

    230OREC-839 Mako (29 Years Old) 3rd Year Of Marriage

  • amateur censoredcreampiemarried womanorecorec-839orec839230orec-839
    • 2021-08-13
    16 min

    FC2PPV 2019389 [Limited to 300 980pt] BG002 Whitening Shortcut F Cup 23-year-old OL Miho-san The first mass bukkake with a blowjob and handjob! !!

  • amateur uncensoredfc2
    • 2021-08-13
    103 min

    300NTK-621 [Gal Model X Yukata = Chemical Reaction Eros Explosion! !! ] Perfect Body Beauty Gal Of Tall Beauty Big Breasts Comes Down! !! Raw Dying Gal Who Panting With Raw Chin Union From Yukata Shooting! !! While Squirting, You Can Get 3 Consecutiv

  • galnn censoredcreampiesquirtingntkntk-621ntk621300ntk-621
    • 2021-08-14
    51 min

    404DBL-0083 Rainy Day Mature Woman 3P! Shoko 47 Years Old & Akemi 52 Years Old

  • amateur censoredcreampiebig titsdbldbl-0083dbl0083404dbl-0083
    • 2021-09-02
    70 min

    [481SACZ-073]奈々 2

  • amateur censoredmarried womanamateursaczsacz-073sacz073481sacz-073
    • 2021-09-09
    122 min

    [FSDSS-290]Beautiful Married Woman Thinking About Cheating All Day. Kanene Yoshitaka

  • nine yoshitaka censoreduniformsingle workFSDSSfalenokei isoifaleno starFSDSS-290FSDSS2901fsdss00290
    • 2021-09-16
    114 min

    [FANH-006]TV Presenter-like Neat and Clean Slender Beautiful Woman Ema-san. Oiled Up Strong Orgasms With 2 Non-stop Cum Loads!

  • censoredamateurblowjobFANHhamedori.network secondeditionFANH-006FANH006h-1472fanh00006
    • 2021-09-17
    172 min

    [JUNY-043]Dirty Men Toy With Curvy Bodied Girl Even While Her Boyfriend Is Right There. Colossal Tits And Massive Ass In Swimsuit Gets Teased By Personal Trainer. Climax NTR Getting Cheated On Pervert. Reo Fujisawa

  • reo fujisawa censoredbig titssingle workJUNYfitchnikuyokuJUNY-043JUNY043juny00043
    • 2021-09-29
    78 min

    259LUXU-1451 Luxury TV 1463 A Beautiful Female Doctor (Proctology) In Her Second Year Of Marriage Appears On AV! Marital Relationship Is Good, But Sex Is Normal And Unsatisfactory! "I Want To Live With All My Strength …" A Beautiful Wife

  • amateur censoredmarried womanamateurluxuluxu-1451luxu1451259luxu-1451



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online