much 085




FC2WAAAPPPDAWDMIDENATRGVHATIDHDKABBANAUKSSDABMIDVSSISBLKDASDNGODAVSAAMBILULUIPX

2020-11-25
58 min

[orec-631]みずほさん 2

  • amateur censoredbig titsamateurorecorec-631orec631orec-631
    • 2020-11-25
    17 min

    10musume 112520_01 Secret Pussy Collection: Keiko Miyahara

  • amateur uncensored10musume
    • 2020-11-27
    65 min

    417SRCN-054 [Love hotel reception girl] An older sister with a relaxed atmosphere works hard to support the virgin ED Ji ● Po! Completely erected Ji ● Po reward SEX! [Onasapo]

  • amateur censoredcreampieamateursrcnsrcn-054srcn054417srcn-054
    • 2020-12-10
    71 min

    230OREC-652 Nana

  • amateur censoredcreampieamateurorecorec-652orec652orec-652
    • 2020-12-10
    77 min

    200GANA-2403 Seriously Nampa, first shot. 1566 Get a sales position OL taking a break in Meguro! Excited by the long time etch! !! Blow job is too cute ♪ Break stockings and w bet is not cool business development now www

  • amateur censoredamateurganagana-2403gana2403200gana-2403
    • 2020-12-12
    149 min

    [DASD-777]She's Made Up Her Mind - Famous Pro Guitarist's Porn Debut! Natsuki Mizuno

  • mizuno nagisa censoredsquirtingbeautiful girlDASDdasinaballDASD-777DASD777dasd00777
    • 2020-12-24
    51 min

    230OREC-665 Yui

  • amateur censoredcreampiebig titsorecorec-665orec665orec-665
    • 2021-01-12
    69 min

    FC2PPV 1642160 First shot ❤️ Complete appearance ☆ 2 consecutive shots too much for active underground idols ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-24
    76 min

    300NTK-507 Bashabasha Squirting Angel Class Beautiful Girl Advent! !! Still growing Echi Echi F cup is also Binkan’s generalized erogenous zone Natural boned nasty the etch SEX In addition, lewd goddess! !! Of course, the fluffy famous instrumen

  • amateur censoredcreampiesquirtingntkntk-507ntk507300ntk-507
    • 2021-01-25
    53 min

    328HMDN-331 [Amateur / 3P individual shooting] 39 years old Enjoy 3P by holding a child-bearing wife with beautiful breasts nice body to a man who met for the first time. Her heart is broken by the fact that anyone can feel it if it is a cock and her

  • amateur censoredcreampiebig titshmdnhmdn-331hmdn331328hmdn-331
    • 2021-02-18
    55 min

    10musume 021821_01 She has a cute face but her back has demon face Nagisa Miyabi

  • amateur uncensored10musume
    • 2021-02-19
    67 min

    FC2PPV 1693268 [Big ass mistress] I was abstinent for a month and went crazy! Dada leaked glossy pantyhose Creampie while wearing clothes!

  • amateur uncensoredfc2
    • 2021-03-01
    58 min

    324SRTD-0215 She volunteered for SEX with big breasts and the highest sensitivity of God’s milk sister!

  • amateur censoredbig titsamateursrtdsrtd-0215srtd0215324srtd-0215
    • 2021-03-06
    239 min

    [TSP-439]Drilled By A Massive Dick Hammer! Female Foreman Gets Drilled! "You'll Catch A Cold If You Lay Down Here..."

  • censoredcreampieamateurTSPtokyo specialmanji groupTSP-439TSP439tsp00439
    • 2021-03-13
    118 min

    [VEO-039]She's Back And Squirting Breast Milk!! Giant Ballon Titties Hinami Narusawa Is In Her Forties And Back In Action

  • hinami narusawa censoredcreampiebig titsVEOvenusbingo tamatsukabornVEO-039VEO039veo00039
    • 2021-03-18
    100 min

    [PRBYB-072]Pure White Sweet Lady/Mami Sakurai

  • censoredbig titsbeautiful girlPRBYBintec incPRBYB-072PRBYB072h-706prbyb00072
    • 2021-05-06
    73 min

    [REBD-552]Tsubaki 2 Southern Shangri La / Tsubaki Sannomiya

  • sannomiya tsubaki censoredsingle workREBDrebeccaherpes takaREBD-552REBD552h-346rebd00552
    • 2021-05-08
    181 min

    [NASH-504]Class Reunion We Went Crazy At Our 30 Year Class Reunion

  • yanagawa midori yuri kariya censoredmature womandramaNASHnadeshikoNASH-504NASH504nash00504
    • 2021-05-10
    61 min

    Caribbeancom 051021-001 Very First Anal Sex With Anger Reika Kudo

  • reika kudo uncensoredanalcreampiecaribbeancom
    • 2021-05-12
    110 min

    459TEN-018 [The strongest erotic ass in history] Assault on the home of Miss F milk cabaret captured in Ebisu! !! Bombshell fuck with a special game underwear for gals! !! Poke the peach butt of the prepuri and poke it! !! Raw vaginal cum shot to the

  • amateur censoredcreampiebig titstenten-018ten018459ten-018
    • 2021-06-09
    72 min

    522DHT-258 [What a Celebrity Wife’s Vulgar Abomination! ] Naked and crawl on all fours and chew other people’s cheeks to the back of your throat! Serve by hanging down! "I want Ochin * n. Please insert it. Insert it quickly!" A lot

  • amateur censoredcreampiemarried womandhtdht-258dht258522dht-258
    • 2021-06-17
    160 min

    [MMKS-014]Teasing Service Soothing Soapland Girl With A Huge Ass Mizuki Yayoi

  • mizuki yayoi censoredsingle workMMKSmarrionkojiro miyamotoirisMMKS-014MMKS014mmks00014
    • 2021-06-19
    72 min

    418YSS-83 Aoi

  • amateur censoredbig titsamateuryssyss-83yss83418yss-83
    • 2021-06-20
    240 min

    [MKMP-404]SUPER COMPLETE BEST Aoi Kururugi

  • aoi kururugi censoredcreampiebeautiful girlMKMPkm producetaro kmillionMKMP-404MKMP404mkmp00404
    • 2021-06-20
    96 min

    [VNDS-3368]A Married Woman Who Sells Life Insurance With A Blowjob 3

  • censoredblowjobhandjobVNDSstar paradisenext toilet r eVNDS-3368VNDS3368h-254vnds03368
    • 2021-07-12
    37 min

    FC2PPV 1917445 Limited number! !! [Uncensored] Creampie for a 20-year-old female college student who works part-time at a girls bar! !!

  • amateur uncensoredfc2
    • 2021-07-14
    204 min

    [HUNTB-061]"If You Keep Pounding Me Like This I'm Going To Lose It!" Virgin Cherry Boy Has It Popped By His Slutty Stepsister And Drives Her To A Real Orgasm! Pinned With Her Tight Legs Wrapped Around Him...

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-061HUNTB061huntb00061
    • 2021-07-17
    240 min

    [REXD-372]Eh!？ It Really Got Me ... The Art Of H*******m Group "It's Okay To Touch It A Little"

  • censoredcreampiebig titsREXDredmanji groupREXD-372REXD372rexd00372
    • 2021-07-17
    150 min

    [CJOD-304]Babe With A Knock-Out Bod Offers Happy Endings - Creampie Included - At Her Gentle, Whispering Massage Parlor JULIA

  • julia censoredcreampiebig titsCJODchijo heaventrendy yamaguchiCJOD-304CJOD304cjod00304
    • 2021-07-17
    118 min

    [NNPJ-459]Picking Up Girls: Landing A Nordic Amateur And Taking Her Back To A Hotel Room To Fuck... Mind-Blowingly Gorgeous Body And Incredible Sex Skills. "Do You Want Me？ (Wanna Do It？)"

  • censoredblowjobNNPJnanpa japanNNPJ-459NNPJ459nnpj00459
    • 2021-07-18
    238 min

    [OKAX-759]Rock Hard And Sensitive! An Erotic Elder Sister Type Will Give Your Nipples Relentless Love And Foreplay And Get You Erect And Ecstatic, And Then She'll Get Your Cock Squirting And Ejaculating!

  • yuki sakuragi yui kawagoe censoredslutOKAXk m produceokazuOKAX-759OKAX759okax00759
    • 2021-08-06
    152 min

    [MIAA-489]My Stepsister Who Put All Her Stat Points Into Her Face And Ass Makes Me Come Again And Again... Ichika Matsumoto

  • ichika matsumoto censoredcreampieslutMIAAmoodyzichinose kurumiminna no kikatanMIAA-489MIAA489miaa00489
    • 2021-08-13
    54 min

    1Pondo 081321_001 Mature Cosplay Nana Kamiyama

  • amateur uncensored1pondo
    • 2021-08-31
    15 min

    FC2PPV 1945751 [Personal Shooting] Business Trip Massage "Y Nippori Store" Mr. O (37) 159cm E Cup Thirty Okusama Take Off And Put On The Back Op At The Ng Store (Hidden Shooting Leaked)

  • amateur uncensoredfc2
    • 2021-10-01
    140 min

    [CAWD-282]My Homeroom Teacher Is Older Than My Parents, But... S*****t Offers Too Much Temptation To Resist, So After School Turns Into A Night Of Sex Till Morning With A Creampie Finish. Mirai Yagami

  • yagami future censoredcreampieuniformCAWDkawaiikannana dainanaCAWD-282CAWD282cawd00282
    • 2021-10-07
    161 min

    [MIST-350]Strike Her Down On Her Danger Day!! A Babymaking Soapland 32 Kanon Kanade

  • kanon kanon censoredbig titssingle workMISTmr michirusaitaMIST-350MIST3501mist00350
    • 2021-10-08
    158 min

    [IPX-742]楓カレン流 極楽射精メンズエステ

  • karen kaede censoredhandjobsingle workIPXidea pocketoosaki hirokoujitissueIPX-742IPX742ipx00742
    • 2021-10-10
    74 min

    534IND-002 Uniform Gachi Beautiful Girl! !! Raw Iki Attitude Is Also Raw Ji ○ Ko And Intense Piss Vaginal Cum Shot Success Or Failure! !! A Large Amount Of Sperm Leaked From Raw Ikima ○ In The Second Round Of Vaginal Cum Shot Without Permission! !! T

  • amateur censoredcreampiebig titsindind-002ind002534ind-002
    • 2021-10-16
    241 min

    [KSBJ-163]Plump Legend Mature Woman BEST 12 People

  • shota chisato natsuko kayama censoredbig titsmature womanKSBJksb planning emanuelKSBJ-163KSBJ163ksbj00163
    • 2021-10-16
    165 min

    [KAGP-198]ご奉仕濃厚フェラチオ マッチングアプリで見つけた令和素人娘10人

  • censoredamateurblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-198KAGP198kagp00198
    • 2021-10-18
    99 min

    FC2PPV 2355301 [Caution For Viewing, Strictly Prohibited For Leakage] 5 Camera Multicam Amateur Av [Sale For 4 Sets] [Caution For Immediate Deletion And Viewing Of Body Baldness] That National University’S Rotten Girl Is Finally 3p Part 1-Part 4

  • amateur uncensoredfc2
    • 2021-10-29
    150 min

    [MIAA-518]A Hated Boss Has A Dick That"s Just Too Perfect... Sexual Harassment And Fucking For Orgasms That Are Beyond Belief, Leading To A Need For More Creampie Sex. Natsu Tojo

  • natsu tojo censoredcreampieblowjobMIAAmoodyzhiroaminna no kikatanMIAA-518MIAA518miaa00518
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    119 min

    [MIDE-991]Seeing My Precious Girlfriend Being Enjoyed By The DQNs In Class Using an Aphrodisiac And Made To Have Sex With You Gives Me A Poor Erection Nana Yagi

  • nana yagi censoredsingle workMIDEmoodyzshouten shiroumoodyz divaMIDE-991MIDE991mide00991
    • 2021-11-01
    123 min

    [AMBI-141]Perverted Step-Dad"s Sex Toy A Beautiful Y********l In Uniform Breaks Up With Her Boyfriend Rion Izumi

  • rion izumi censoredcreampieuniformAMBIplanet plusdirector oanbibarentsuAMBI-141AMBI141h-237ambi00141
    • 2021-11-19
    158 min

    [DVDMS-738]A Normal Boys And Girls Focus Group Adult Video We Followed Up On A Stepmother And Her Stepson To See What Happened In This Special On The Other Side Of That One-Way Mirror Is His Newly Married Dad! This Cherry Boy Stepson And His Big Tits

  • censoredcreampiebig titsDVDMSdeepsyo sukeDVDMS-738DVDMS738dvdms00738



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online