otoko noritasu




FC2VEMAHNDVENXSSISSQTEMIDESDABMIDVPPPDRBDGVHNACRDTTMIAAMEYDAVSAMARACAWDPREDKBI

2020-09-30
46 min

FC2PPV 1517997 [Uncensored / No Mo] Buyer review benefits available (high quality version) _ New limited sale until 10/31 [1980pt⇒1480pt] [It’s not bad to take it off] Yu & Misa (Rise, Meru) [Complete appearance] Clothes 3P Creampie SEX

  • amateur uncensoredfc2
    • 2020-10-07
    115 min

    Caribbeancom 100720-001 Quick Shooting: The Best of Mio Futaba Mio Futaba

  • mio futaba uncensoredcreampiecaribbeancom
    • 2020-10-24
    119 min

    [HND-902]On Vacation With My Girlfriend And Her Best Friend... We Shared A Room, And When I Got Busy With My Girlfriend It Made Her So Horny That She Seduced Me Into Creampie Sex Until Dawn Rin Kira

  • kira rin meiko nakao noa censoredcreampiebeautiful girlHNDhon nakaryo inugamiHND-902HND902hnd00902
    • 2020-11-13
    156 min

    [DGCESD-946]*Delivery Only! With Bonus Video *Non-stop Tearful Cumming SEX 2 Yui Kawai

  • yui kawai censoredcreampiemature womanDGCESDcelebrity friendsDGCESD-946DGCESD946dgcesd00946
    • 2020-12-01
    140 min

    [STARS-305]Makoto Toda - 12 Loads In A Single Day - Sizzling Creampie Day Trip To A Hot Spring

  • makoto toda censoredcreampiebeautiful girlSTARSsod createzaku araiSTARS-305STARS3051stars00305
    • 2020-12-09
    75 min

    [MBF-004](FANZA Exclusive) (Online Only) Husband And Wife In Name Only - Girls Getting Cheated On And Girls Who Cheat - Yui Hatano Hibiki Otsuki Part One - Wives Who Scheme To Break Couples Up

  • yui hatano otsuki sound censoredcreampiebig titsMBFmax ak c takedaMBF-004MBF004mbf00004
    • 2020-12-25
    47 min

    [DHT-225]A More-Than-20-Years-Age Gap May-December Romance Set Up On A Hookup App Seducing Girls Who Love Withered Old Men Chikako 20 Years Old

  • censoredamateurbeautiful girlDHThot entertainmententhusiastDHT-225DHT22559dht00225
    • 2021-01-01
    52 min

    396BIG-092 Aoi

  • amateur censoredcreampieamateurbigbig-092big092396big-092
    • 2021-01-08
    21 min

    FC2PPV 1637265 [Real-time ranking 1st place commemorative special price] The second beautiful girl Mai-chan! Unauthorized vaginal cum shot sex after cum swallowing sperm in rubber!

  • amateur uncensoredfc2
    • 2021-01-14
    16 min

    HEYZO 2435 Sena’s Amazing Hand Job – Sena Sakura

  • sena sakura uncensoredhandjobheyzo
    • 2021-01-16
    56 min

    H0930 tk0027 Izumi Tobe 32years old

  • amateur uncensoredh0930
    • 2021-01-21
    124 min

    [RCTD-379]Anytime, Anywhere! Shota-exclusive "Ejaculation Beginner's Mark"

  • misono waka yui kawagoe censoredbig titsnurseRCTDrockettaro kanbeRCTD-379RCTD3791rctd00379
    • 2021-01-30
    68 min

    FC2PPV 1664785 [Grated brush] If you can graduate from an active JD / G cup gravure with a deviation value of over 70! Where is more happiness？ The condition is to win the game! Big tit fucking, vaginal cum shot, complete appearance

  • amateur uncensoredfc2
    • 2021-02-03
    64 min

    FC2PPV 1670452 [Limited quantity 2980pt → 1980pt] Super beautiful busty Miss Menes ❤️ Sakura Ichinose ❤️ Hidden camera again without discipline (glasses type camera + 2 turtles) ❤️ Do you like Miss Menes who really serves？ Many purchase benefits

  • amateur uncensoredfc2
    • 2021-02-05
    240 min

    [BUR-563]A Naive Beautiful Country Girl's Outdoor Obscene Mischief Video Collection, 4 Hours

  • censoredcreampiebeautiful girlBURgraysburstBUR-563BUR56312bur00563
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    51 min

    359TYVM-129 Bristles Plump Big Breasts Wife Gun Thrust Cum Inside Fuck! !!

  • amateur censoredcreampiebig titstyvmtyvm-129tyvm129359tyvm-129
    • 2021-02-21
    167 min

    [CAWD-184]An Active Gymnast That People Called Their Local Fairy Said, "I Really Have A Strong Libido..." She Really Wanted To Have Sex, So She Took The Shinkansen From Tohoku And Made Her Debut In Tokyo - Rui Minagawa

  • rui minagawa censoredbig titssingle workCAWDkawaiitake dCAWD-184CAWD184cawd00184
    • 2021-02-22
    130 min

    [BTIS-111]Beautiful Crossdressing Prostitute 8 - Akari

  • censoredBTISbeautiful boy publishing.companykamon seijoicross dressing sexy boyBTIS-111BTIS111btis00111
    • 2021-02-28
    76 min

    200GANA-2448 Seriously Nampa, first shot. 1604 Hotel IN at Tay who picks up an older sister with beautiful legs and listens to consultations! Frustrated when she touches her body while consulting her troubles, she is gradually swept away, opens her l

  • amateur censoredamateurganagana-2448gana2448200gana-2448
    • 2021-03-09
    42 min

    H0930 ki210309 Risa Naruse 38years old

  • amateur uncensoredh0930
    • 2021-03-13
    122 min

    [EYAN-166]When He Shoved His Cock Into Her Pussy, She Began To Cum While Squirting Breast Milk Minami-san Keeps On Wanting More Helpings Of Cock, No Matter How Many Times She Has Cum!! After Being Neglected For So Long, This Breast Milk Squirting H-C

  • censoredbig titsamateurEYANe bodytakuanwives of hanasagariEYAN-166EYAN166eyan00166
    • 2021-03-31
    47 min

    292MY-449 Rin Fujisaki

  • amateur censoredmarried womanamateurmymy-449my449292my-449
    • 2021-04-27
    132 min

    [PAIS-002]Plain Jane Girl With Big Tits Who Came To Tokyo From The Countryside She Makes Her Porn Debut On The Same Day She Enters College

  • censoredbig titsamateurPAISmercurychabozu tea boypie otsukai day clubPAIS-002PAIS002h-1133pais00002
    • 2021-04-29
    120 min

    [013ONEZ-288]僕のことが大好きすぎる会社の後輩に誘惑されて・・・相部屋ホテルで仕事もサボってひたすらSEXしていた件 石原める

  • amateur censoredcreampieuniformonezonez-288onez288013onez-288
    • 2021-04-30
    51 min

    C0930 tk0033 Mariko Sakanishi 26years old

  • amateur uncensoredc0930
    • 2021-05-01
    150 min

    [PRED-312]On That Furiously Cold, Rainy Day ... I Was With My Elder Sister Type Big Tits Private Tutor, And She Demanded That I Kiss Her More Passionately, And We Warmed Our Bodies With Creampie Sex That Night. Maron Natsuki

  • marin natsuki censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-312PRED312pred00312
    • 2021-05-01
    108 min

    [ID-031](Ear-Plugged Sex) I Ordered A Female S*****t Delivery Health Call Girl And She Turned Out To Be A Boyish Slut (My Beloved Delivery Health Call Girl) Nanami Ozora

  • sena ai censoredcosplaybeautiful girlIDtmaID-031ID0315526id00031
    • 2021-05-01
    119 min

    [JUL-563]Adulterous Trip Disguised As A Business Trip Yuna Kitano

  • yuna kitano censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-563JUL563jul00563
    • 2021-05-02
    96 min

    [VEMA-163]Creampie Field Trip With A Hairy Pussy Female Teacher Who Just Wants To Fuck Ren Usui

  • usui ren censoredcreampiebig titsVEMAvenuskaniemegami venusVEMA-163VEMA163vema00163
    • 2021-05-21
    117 min

    [NNPJ-448]This Is The First Time I've Ever Used A Dating App To Meet Men... Bored, Sex-Starved Married Woman Goes To A Love Hotel Just This Once With Another Man Ms Aki

  • censoredcreampiebig titsNNPJnanpa japanNNPJ-448NNPJ448nnpj00448
    • 2021-06-04
    156 min

    [SSIS-079]Directed To Take The Longest Dry Spell In Our Label's History: Sex Prodigy 'Miru' Has Gone Without An Orgasm For Three Whole Months! We Send Her To The Homes Of Amateur Fan Where She Goes Off Script To Satisfy Her Ravenous Carna

  • miru censoredsquirtingbeautiful girlSSISs1 no 1 styleichigoharaSSIS-079SSIS079ssis00079
    • 2021-06-12
    241 min

    [NASH-522]A Married Woman Who Turns Her Husband Into A Cuckold While He Doesn't Notice

  • ayako inoue kumi kanzaki censoredmature womandramaNASHnadeshikoNASH-522NASH522nash00522
    • 2021-06-17
    51 min

    H0930 ki210617 Yoshiko Yamauchi 31years old

  • amateur uncensoredh0930
    • 2021-06-25
    32 min

    359TYVM-168 Sexually Cheating Cheating Wife Get Drunk With A Big Cock And Cum Sex! !!

  • amateur censoredcreampiemarried womantyvmtyvm-168tyvm168359tyvm-168
    • 2021-07-03
    100 min

    300NTK-598 [Official NTR! !! Public masturbation] The strongest sensitive GAL of beautiful G breasts urgently participates! !! The heart of a maiden who is too erotic and half-breasted polo is a pure boyfriend! ？？ His willingness to become an actor&#

  • galntrg censoredcreampiebig titsntkntk-598ntk598300ntk-598
    • 2021-07-10
    238 min

    [UMSO-405]"I Really Want to Extend the Time...." A Married Woman Committing Adultery Wants to Keep Fucking Right Until the Love Hotel Time Limit is Up.

  • censoredamateurmature womanUMSOk m producepermaumanamiUMSO-405UMSO405umso00405
    • 2021-07-11
    65 min

    300NTK-603 [Procession maker Gachikawa signboard girl x sensitive treasure x super high sensitivity = Han’s dream! !! ] Even though it is a tapioca shop, a long line of male customers makes a long line of beautiful & too cute signboard girls

  • amateur censoredcreampieamateurntkntk-603ntk603300ntk-603
    • 2021-07-15
    105 min

    [BBTU-016]Boobie Gal Bitch Shuri Hazuki

  • hazuki shuri censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-016BBTU016bbtu00016
    • 2021-07-16
    49 min

    230OREC-824 Kanna

  • amateur censoredcreampiemarried womanorecorec-824orec824230orec-824
    • 2021-07-24
    57 min

    [DANDAN-004]"I'm An Old Lady, But I Can't Control Myself Anymore ..." I Was At A Men's Massage Parlor That Didn't Allow Any Nookie, But This Sexy Therapist Kept On Luring Me To An Erectile State, So She Offered Me Several Con

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-004DANDAN0041dandan00004
    • 2021-08-10
    480 min

    [KTRA-322]Tiny-Breasted A-Cup Beautiful Girls: A Succession Of SEX With Ten Girls For 8 Hours: 2-DVD Set.

  • mie yazawa shinozaki mio censoredcreampiebeautiful girlKTRAke toraibuk tribeKTRA-322KTRA322h-094ktra00322
    • 2021-09-03
    160 min

    [MIAA-496]A Convenient, Plain Jane Big Tits Girl In Glasses This Young Office Lady Is An Obedient Bitch With Rock Hard Nipples, And After I Fondled Her Voluptuous Body, I Creampie Fucked Her Until The Break Of Dawn, Over And Over Again, And It"s

  • yoshine yuria nana matsumoto censoredcreampiebig titsMIAAmoodyztorendei yamaguchiminna no kikatanMIAA-496MIAA496miaa00496
    • 2021-09-03
    148 min

    [JUFE-322][VR] My Friend"s Mother Goes After Young Guy"s Dick And Works It Hard Like A Slutty Milf Gal. REMI

  • rin asahi censoredcreampiebig titsJUFEfitchJUFE-322JUFE322jufe00322
    • 2021-09-07
    83 min

    261ARA-505 [Refreshing] [Transcendent Legs] Miu-Chan Is Here! !! The Reason For Applying For A Beautiful Girl Is "I Want Ji-Po ♪" She Works At A Cat Cafe, But She Has The Healing Of A Cat, But She Has No Desire To Satisfy Her Ass "Ji-Po&q

  • amateur censoredamateuraraara-505ara505261ara-505
    • 2021-09-10
    77 min

    [stcv-020]あいな

  • amateur censoredcreampieamateurstcvstcv-020stcv020stcv-020



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online