rakuda




FC2HMNPPPDHUNTBJUFEMILKVEMAMEYDAVSADASDAWDCHRVKBIDTTHNDKSBJNATRABWMARAVENXMIDE

2020-12-25
121 min

[SGA-147]The Ultimate Creampie Sex With The Ultimate Mistress 61: A Perverted, Beautiful Woman With G Cup Tits And Filthy Ass Who Loves Getting Spanked

  • censoredcreampiebig titsSGAprestigesetsugekkaSGA-147SGA147118sga00147
    • 2020-12-26
    155 min

    [MIAA-371]Double Temptation Of Two Former Girlfriends: Whispering Dirty Slutty Talk Into Both My Ears, And Making Me Creampie Them! With Ai Mukai And Noa Eikawa

  • ai mukai sakaegawa noa censoredcreampieslutMIAAmoodyzham the mceveryone s porn starMIAA-371MIAA371miaa00371
    • 2021-01-01
    83 min

    259LUXU-1368 Luxury TV 1347 Beautiful beauty salon owner is here! A lustrous body with a thorough sense of beauty transforms into a frustrated body in busy days. Although he shows tension and embarrassment to the big cock that he saw for the first ti

  • amateur censoredamateurluxuluxu-1368luxu1368259luxu-1368
    • 2021-01-09
    65 min

    SIRO-4345 [First shot] [Screaming baby-faced girl] [Powerful nice ass cowgirl] A pure female college student who still has the innocence of a girl. If you advance to the extent that the developing beauty man is about to break, the girl will panting w

  • amateur censoredamateursirosiro-4345siro4345siro-4345
    • 2021-01-09

    FC2PPV 1638040 [Exclusive amateur individual shooting] Bold raw Gonzo in a mixed bathing open-air bath with overwhelming looks beauty saffle and midday! Killing your voice in a thrilling situation, midwinter outdoor naked SEX !!

  • amateur uncensoredfc2
    • 2021-01-15
    120 min

    [MDTM-695]All POV: Sugar Baby In Uniform Miu Narumi

  • narumi miu censoredcreampieuniformMDTMuchu kikakutodoMDTM-695MDTM695h-585mdtm00695
    • 2021-01-15
    244 min

    [NASH-435]Real Sexy Stories 18

  • maria serizawa anju minase censoredNASHnadeshikoNASH-435NASH435h-067nash00435
    • 2021-01-21
    124 min

    [FSDSS-159]U-IJIN 01 - Fresh Face: Meisa Kawakita

  • kawakita meisa censoredbeautiful girlsingle workFSDSSfalenoboomer 44faleno starFSDSS-159FSDSS1591fsdss00159
    • 2021-01-31
    60 min

    [orex-247]あやせさん

  • amateur censoredamateurorexorex-247orex247orex-247
    • 2021-01-31
    142 min

    [MDUD-452]Wataru Ishibashi's Amateur Creampies

  • censoredcreampieamateurMDUDart modewataru ishibashiartmodeMDUD-452MDUD452mdud00452
    • 2021-02-08
    33 min

    FC2PPV 1678024 [Active CA, 7th] Miyo-san ② ♡ 24 years old ♡ Blindfolded ♡ Limited time offer

  • amateur uncensoredfc2
    • 2021-02-18
    116 min

    [PPPD-906]Side-Boob Erogenous Zone Development Clinic Saeko Hiiragi

  • hiiragi saeko censoredbig titssquirtingPPPDoppaiPPPD-906PPPD906pppd00906
    • 2021-03-01
    119 min

    [SMSD-022]Female Prisoner Illusion - Aya Shiomi

  • aya shiomi censoredbdsmsingle workSMSDs m sniperSMSD-022SMSD022h-1126smsd00022
    • 2021-03-05
    66 min

    [SZKK-023]That Our Stepdaughter Would... - R-18/Minori Kurada

  • suzumiya kotone censoredsoloworkSZKKorustak softmasturbation supportSZKK-023SZKK023
    • 2021-03-19
    142 min

    [TNOZ-003]Titanic Tits: Rural Cosplayer (Age 19) With A Submissive Streak (Everybody Gets A Titty & Nipple Fuck & Cums On Her Tits) P-Cup With Enormous Nipples Ravished By 12 Continuous Loads In A Titty Fuck Four-Some Orgy, Spitroasted By 2 Guy

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-003TNOZ003tnoz00003
    • 2021-03-19
    128 min

    [MKON-048]My Girlfriend Found Out About My NTR Hangup, And So, On My Birthday, Perhaps Thinking That I Liked That Kind Of Thing, She Showed Me A Video Of Her Getting Creampie Fucked By Some Strange Old Man Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampiesingle workMKONkaguyahimept mousouzokuichiro yumisakimikonMKON-048MKON048mkon00048
    • 2021-04-05
    376 min

    [DANUHD-002]The Mysterious Princess With A Shaved Pussy: Nadia 18 Years Old AV Debut + 1 Work

  • nadia censoredbeautiful girlsingle workDANUHDdandydandyuhdDANUHD-002DANUHD0021danuhd00002
    • 2021-04-09
    146 min

    [IPX-635]I Can't Live Without Sex Anymore... 159 Incredible Orgasms, 2048 Pussy Spasms, 3211 Thrusts, Squirting With Pleasure, Her Erotic Awakening Miu Shiromine

  • shiramine miu censoredsquirtingsingle workIPXidea pocketdragon nishikawadishIPX-635IPX635ipx00635
    • 2021-04-14
    179 min

    [SSIS-046]While Your Girlfriend Was Away Her G-Cup Little Sister Seduced You Into Fucking Her All Day Long - 72 Hours Caught On Camera. Mahina Amane

  • amane mahina censoredbig titsslutSSISs1 no 1 stylebungo maedaSSIS-046SSIS046ssis00046
    • 2021-04-17
    211 min

    [DASD-855]Genuinely Addicted to Anal Fucking: Roughing It Into All Holes SP

  • censoredanalbig titsDASDdaskogoro kindaichiDASD-855DASD855dasd00855
    • 2021-04-27
    138 min

    [STARS-363]In The Futon All The Time... Non-stop Vaginal Cumshots With Sticking Piston Fucking - Yuna Ogura

  • yuna ogura censoredbeautiful girlsingle workSTARSsod createsuisei akaisod starSTARS-363STARS3631stars00363
    • 2021-05-03
    59 min

    10musume 050321_01 A Cute Influencer is Interested in Adult Toys Yuko Takano

  • amateur uncensored10musume
    • 2021-05-09
    13 min

    10musume 050921_01 Pussy Collection: Please look at Kanade’s pussy Kanade Mio

  • amateur uncensored10musume
    • 2021-05-19
    124 min

    [GVH-232]Naughty Nurses: Kokone Nakamura

  • nakamura here censoredcreampiegrandfatherGVHglory questham the mcGVH-232GVH23213gvh00232
    • 2021-06-02
    105 min

    [ARM-984]Kurumi Suzuka And Eve Otohana Are Lezzing It Up At The Office, So The Boss Can't Keep His Cock Down - Kurumi Suzuka, Eve Otohana

  • suzuka walnut otohana eve censoredlesbianARMaroma kikakuhamu oujiaromaARM-984ARM984arm00984
    • 2021-06-12
    121 min

    [MDTM-731]Complete POV Quickie Impregnation Fucking Submissive Maid Kurumi Momota

  • hyakuta walnut censoredcreampieblowjobMDTMuchu kikakutodoMDTM-731MDTM731mdtm00731
    • 2021-06-17
    100 min

    [HONE-261]I Was Watching My Stepmama's Wet Nipples. Hitomi Misono

  • hitomi misono censoredcreampiemature womanHONEcenter villagejiro fukagawahona zonoHONE-261HONE261h-086hone00261
    • 2021-07-09
    146 min

    [IPX-690]Her Older Sister Is A Bikini Model Jiggly Breast Massage Cum Shot Intense Piston! Momo Sakura

  • sakura sky momo censoredcreampiebig titsIPXidea pockettissueIPX-690IPX690ipx00690
    • 2021-07-10
    173 min

    [SCPX-428]My Stepson is a Troublesome Sex Monster...

  • censoredcreampiebig titsSCPXscoophasshimousouzokuSCPX-428SCPX428scpx00428
    • 2021-07-19
    65 min

    HHSI-005 Karen

  • amateur censoredamateurhhsihhsi-005hhsi005hhsi-005
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-07-22
    118 min

    [WAAA-082]Squirting And Fucking Like Animals In A Locked House For 3 Days And 3 Nights-JULIA

  • julia censoredcreampiebig titsWAAAwanz factorywanzWAAA-082WAAA082waaa00082
    • 2021-08-06
    35 min

    FC2PPV 1962287 None [Limited To 100 Pieces 2980 → Off To 1480pt!] This Girl’S Blowjob Is Too Amazing! De Metamorphosis! Instead Of A Nyodo Straw, Suck Up Chuchu Gaman Juice! * Review Benefits / High Image Quality Ver

  • amateur uncensoredfc2
    • 2021-08-20
    51 min

    FC2PPV 2050617 Men’s Esthetic Training Hidden Shooting (Karen 24 Years Old) -Silver ● Slowly Attack An Elegant Fair-Skinned Beauty Nail Technician Who Works At A Luxury Salon With A Hand Man And Insert It Raw Into A Sloppy Maco

  • amateur uncensoredfc2
    • 2021-08-28
    44 min

    [PSST-031]Two Holes At Once! Blond Married Woman Gets Filled Up For Double Dick Penetration - Pussy And Anal! Winny

  • censoredmarried womanamateurPSSTpatzkin amateurbooker tPSST-031PSST031h-1450psst00031
    • 2021-09-03
    166 min

    [CLUB-650]I Learned That The Bad Girl Who Used To Bully Me Is Now A Beautiful Married Woman Running A Massage Parlor With Some Extra Sensual Services, So I Took Revenge By Having Creampie Sex With Her 27

  • censoredcreampiebig titsCLUBhentai shinshi kurabuCLUB-650CLUB650club00650
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-19
    90 min

    345SIMM-666 [Easy Delivery Type Muchimuchi J ○] Anna-Chan, The Captain Of The Women’S Baseball Club, Is An Active Athlete School Girl With A Full-Body Muchimuchi! !! It’S Been A Long Time Since I Had A Date With Her Uncle, And Anna-Chan, Wh

  • amateur censoredcreampiebig titssimmsimm-666simm666345simm-666
    • 2021-09-23
    53 min

    FC2PPV 2240112 First Shot [Uncensored] Nanami Hashimoto / Three Close Contacts With Camp Girls. In A Narrow Vagina In Various Places During An Interview Outside In Her Room

  • amateur uncensoredfc2
    • 2021-09-30
    52 min

    C0930 ki210930 Kimie Isobe 26years old

  • amateur uncensoredc0930
    • 2021-10-01
    165 min

    [MIFD-182]I Want To Be A Reborn As A Nerd Group Queen! Anime Fan Club Real College Girl Porn Debut, Aoi Kyobashi

  • kyobashi aoi censoredblowjobbeautiful girlMIFDmoodyzkirinmoodyz freshMIFD-182MIFD182mifd00182
    • 2021-10-07
    87 min

    [HIMA-095]Genuine A Stepmother/Stepson Fuck Fest A Stepmother And Stepson Have Nowhere To Turn To But Each Other, As They Engage In Forbidden Impregnation Sex Kanako Haraguchi

  • natsuko haraguchi censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-095HIMA095h-086hima00095
    • 2021-10-12
    480 min

    [MUCH-139]Sex with 10 Really Horny, Busty Beautiful Cougars, 8 Hours, A Set of 2 DVDs

  • mikimoto nozomi naho hazuki naho hazuki censoredbig titsmature womanMUCHmothermuchimuchiMUCH-139MUCH139h-796much00139
    • 2021-10-20
    89 min

    [VNDS-3377]An Old Man (A 35-Year Old Unemployed Stepson) Who Lives In A Little Boy"s Room Gets Sexual Satisfaction With His Stepmom Saryu Usui

  • sakisui censoredcreampieblowjobVNDSstar paradisenext11VNDS-3377VNDS3377h-254vnds03377
    • 2021-10-22
    99 min

    [YSN-562]My New Mother-in-law Is A Devil But My Erection Won"t Go Away. Kanna Hirai

  • shiori hirai censoredcreampieblowjobYSNnonYSN-562YSN562h-127ysn00562
    • 2021-10-25
    96 min

    300MIUM-768 A Tight Xs With One Finger ● Travel With This Beautiful Girl! Although It Is Delicate, The Fair-Skinned Body Of The E-Cup Is Full Of Gaps And You Can See The Cancer! !! For The First Time In 3 Years, I Haven’t Experienced Ji ● Po Ine

  • amateur censoredcreampieamateurmiummium-768mium768300mium-768



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online