restraint high vision housewife jav censored




FC2AUKGAMBIPREDAUKSHUNTBCESDBLKNACXPPPDMIAAAWDWANZMIDVHNDDTTFSDSSSQTESSNISPRDGMEM

2020-12-23
91 min

[SDHS-017]Horny Sluts Satisfy Themselves With The Creampie Dildo Of Their Dreams

  • iori furukawa masami ichikawa censoredbeautiful girlSDHSsod createSDHS-017SDHS0171sdhs00017
    • 2020-12-27
    149 min

    [FONE-128]10 Liters Of Squirting! My House Is Gonna Wash Away! Bratty Little Runaway Girl Splatters Older Guy's Entire Face With Pussy Juice And He Catches The Whole Thing On Camera - Fuka - Footage By: Single Male Sub (Age 39)

  • censoredcreampiesquirtingFONEfirst starplus first starFONE-128FONE128h-491fone00128
    • 2020-12-31
    230 min

    [HUNTA-907]I First Noticed My C***dhood Friend Was Hot On Her Way Back From A Bath Wearing Barely Anything - I Couldn't Control Myself And We Wound Up Having A Sweaty, Orgasmic Fuck! Is This How Male/Female Friendships Should Be？...

  • censoredcreampieblowjobHUNTAhunterkonjac kanohhh groupHUNTA-907HUNTA907hunta00907
    • 2021-01-07
    19 min

    FC2PPV 1635569 1800pt → 900pt [Gonzo] A married woman who is in an affair is blamed for denma at a remote hotel and rich SEX

  • amateur uncensoredfc2
    • 2021-01-09
    83 min

    FC2PPV 1637727 [Limited quantity] Taki ◯ Rie ④ (long ver) Takimoto Rie

  • amateur uncensoredfc2
    • 2021-01-09
    151 min

    [IPX-603]Airi Kijima Untarnished Sex, For Real "If I Get A Boyfriend For The First Time In 10 Years, This Is The Kind Of Sex I Want To Have" That's How This Idea Started No Script, No Direction... This Is Simply A Private Video Of Her, Fi

  • airi kijima censoredblowjobsingle workIPXidea pocketmichiru arashiyamadishIPX-603IPX603ipx00603
    • 2021-01-12
    115 min

    [KTRA-266]Tempted Into Creampie Sex By A Big Titted Stepsister - Aoi Morinaga

  • morinaga aoi censoredbig titsuniformKTRAk tribeKTRA-266KTRA266h-094ktra00266
    • 2021-01-13
    46 min

    FC2PPV 1643130 Until the 16th [Individual shooting] Prefectural general course ② Honor student with long black and white hair. Gonzo is taken by a cram school teacher.

  • amateur uncensoredfc2
    • 2021-01-15
    47 min

    FC2PPV 1645981 A sincere blowjob bite that tastes the erection cock deliciously with the whole tongue! A super erotic face with a naive face and an amateur population! Cum shot in the mouth after letting me put it in the vagina a little irresistibly

  • amateur uncensoredfc2
    • 2021-01-19
    139 min

    [STARS-323]Mana Is A Beautiful Lady Boss Who Hates My Guts, And I Can't Abide By That, So I'm Going To Send Her To A Massage Parlor And Have Her Converted To Fit My Tastes! Mana Sakura

  • mana sakura censoredbig titssingle workSTARSsod createryo inugamisod starSTARS-323STARS3231stars00323
    • 2021-01-20
    98 min

    300MIUM-671 [Can you tear off your nipples？ ] Unexpectedly pigmented adult nipples of an unfussy office lady who works for telework in a girly room are pulled around and played with, and the unbearable man who works from home shines in the sunshine.

  • amateur censoredbig titsamateurmiummium-671mium671300mium-671
    • 2021-01-28
    127 min

    [MOND-209]My Sexy Boss Miho Takasugi

  • miho takasugi censoredsingle workMONDtakara eizohotate ikkandaiichi housouMOND-209MOND20918mond00209
    • 2021-02-05
    75 min

    259LUXU-1377 Luxury TV 1362 A fascinating beauty busty bank clerk who says it was developed in the previous shoot and is easier to feel is back! Keep an eye on her too dense instinct full-blown sex that became a hedonist, exposing her glamorous body

  • amateur censoredbig titsamateurluxuluxu-1377luxu1377259luxu-1377
    • 2021-02-05
    63 min

    [HYPN-038]Sex Magic Service - Get Revenge On Your Cheating Wife! Slut Transformed Into An Unwitting Fuck Puppet Right In Front Of Her Husband Momo Hazuki

  • hazuki peach censoredcreampiesquirtingHYPNsod createsatoshi morikawamind controlHYPN-038HYPN0381hypn00038
    • 2021-02-06
    120 min

    [SSNI-978]My Wife Started Doing Radio Workouts - Her Sweaty Routine Starts At 6:25 AM And Includes Nailing A College S*****t 7 Years Younger Than Her... Minami Kojima

  • minami kojima censoredsingle workSSNIs1 no 1 stylek westSSNI-978SSNI978ssni00978
    • 2021-02-12
    150 min

    [MIFD-147]We Can't Tell You The Name Of The Shop, But This 20-Year-Old Fresh Face Works At A Vintage Clothing Store In Koenji - Chubby, Stylish Cutie With Short Hair That Suits Her Makes Her Porn Debut! Tsugumi Makoto

  • makoto tsugumi censoredsingle workMIFDmoodyzusa pyonmoodyz freshMIFD-147MIFD147mifd00147
    • 2021-02-17
    51 min

    [sika-040]みさみさ 2(20)

  • amateur censoredcreampieamateursikasika-040sika040sika-040
    • 2021-02-22
    110 min

    [THNIB-069]A Pure Young Beauty Working At The Cafe ~ I'm Always Waiting For Your Return ~ Aya Mamiya

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-069THNIB069h-706thnib00069
    • 2021-02-24
    40 min

    [SDFK-042]"Couples Only" In The One-Way Mirror Cab, Your Girlfriend Tries Out A Real Cheating Creampie! Mika (18), College S*****t

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-042SDFK0421sdfk00042
    • 2021-02-26
    115 min

    [PARATHD-3107](Emergency Broadcast) Remote-Controlled Egg Vibrators Are Making Girls Cum Across The Whole Country! Complete Edition Miku Abeno

  • miku abe censoredPARATHDparadise tvPARATHD-3107PARATHD3107parathd03107
    • 2021-03-02
    125 min

    [STARS-356](Enjoy Yourself In 4K!) Big Titty Cosplayers! Titty Fucking Full Course Brothel Kurumi Hanamaru

  • hanamaru kurumi censoredbig titscosplaySTARSsodzach araiSTARS-356STARS3561stars00356
    • 2021-03-13
    121 min

    [BAHP-070]Extreme Pervert - Masochistic College Girl Gets Tied Up And An Extreme Throat Fuck - Reika Nakajo

  • nakajo suzuka censoredlingeriedeepthroatBAHPbaltandaibutsu yoshidahoppinBAHP-070BAHP070bahp00070
    • 2021-04-02
    58 min

    FC2PPV 1743341 [Personal shooting] Kanade 32 years old Massive launch to a sweat duck beautiful wife with outstanding style F cup beauty big tits

  • amateur uncensoredfc2
    • 2021-04-09
    117 min

    [IPX-640]Massage Parlor Slut In Lingerie Gently Teases You With Dirty Talk - You Can't Go Home Until You Cum Anna Kami

  • anna kami censoredslutsingle workIPXidea pocketdishIPX-640IPX640ipx00640
    • 2021-04-10
    141 min

    [USAG-027]K-Cup/Colossal Tits/3 Fucks/Creampie/Self-Shot "Seeing Yourself Be This Sexy Will Give You Confidence" She's Normally Shy, But Not In The Bedroom! Girl Gets Bred With Thick, Creamy Cum!

  • censoredcreampiebig titsUSAGrabbit daydreamersUSAG-027USAG027usag00027
    • 2021-05-17
    60 min

    499NDH-017 [Girl’s bar signboard girl in Shinjuku. ] Big breasts H cup bunny costume clerk who wore fishnet tights with a high degree of etch was persuaded with two champagnes! [Rumor! Tokyo signboard girl. 2nd person]

  • amateur censoredbig titsamateurndhndh-017ndh017499ndh-017
    • 2021-05-20
    120 min

    [ARSO-21146]My Wife -Celeb Club- 146

  • masaru momose miu nonomura censoredblowjobARSOaroundARSO-21146ARSO21146h-1378arso21146
    • 2021-06-04
    121 min

    FC2PPV 1851765 980 yen! The contents are full ♪ After all, an angel! ？？ All you want to do for a beautiful girl with big breasts ♪ Full of back ops (rimming, facial cumshots, electric drill, anal fingering) Angel Naten-chan gets sharp？ One vaginal cu

  • amateur uncensoredfc2
    • 2021-06-08
    45 min

    H0930 ki210608 Kana Iwamoto 45years old

  • amateur uncensoredh0930
    • 2021-06-12
    62 min

    1Pondo 061221_001 Naughty Kiss And Fucking: Riri Shiraki

  • amateur uncensored1pondo
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-05
    91 min

    DCH-006 Nana

  • amateur censoredcreampieamateurdchdch-006dch006dch-006
    • 2021-07-09
    180 min

    [EBOD-838]Tired of living in self-restraint, I picked up a super horny slut with a G cup in a club. She told me she'd give me a blowjob and in the men's toilet, I came in her mouth. We were still so turned on that we immediately left to fuck

  • censoredbig titsEBODe bodytorendei yamaguchiEBOD-838EBOD838ebod00838
    • 2021-07-17
    118 min

    [CAWD-258]"Boss, I'll be on a Date Until Morning." Overtime reverse Secret Sex with NTR Wife. Cumming in a Slut Who Rides Me after Making Fun of Me for Working Overtime. Sarina Momonaga.

  • sarina momonaga censoredcreampieslutCAWDkawaiitiger kosakaiCAWD-258CAWD258cawd00258
    • 2021-07-22
    153 min

    [JUFE-313]Infinite Orgasms With Just Titty Teasing-Riho Fujimori

  • riho fujimori censoredslutsingle workJUFEfitchsamoariJUFE-313JUFE313jufe00313
    • 2021-07-22
    118 min

    [WAAA-082]Squirting And Fucking Like Animals In A Locked House For 3 Days And 3 Nights-JULIA

  • julia censoredcreampiebig titsWAAAwanz factorywanzWAAA-082WAAA082waaa00082
    • 2021-07-25
    17 min

    FC2PPV 1939347 [Individual Shooting] Ordinary Course Black Hair Big Breasts ③ Ignorant Girl, Unwanted Pregnancy, Abortion Compensation Creampie To Two Uncles

  • amateur uncensoredfc2
    • 2021-07-31
    58 min

    Pacopacomama 073121_509 She Got A Sex Toy In Her Vagina: Cute And Sophisticated Looking Wife Is So Horny! Hitomi Okano

  • amateur uncensoredpacopacomama
    • 2021-08-06
    150 min

    [MIAA-487]The Petite Girl Is Matting Pressed By A Fan With A Huge Dick That Came To A Photo Shoot.

  • censoredcreampiedeepthroatMIAAmoodyzakai suiseiminna no kikatanMIAA-487MIAA487miaa00487
    • 2021-08-06
    129 min

    [HODV-21598][Complete Subject] Osaka dialect Girl Yuzuki Otoha

  • yuzuki otoha censoredcreampiesingle workHODVh m pHODV-21598HODV215985642hodv21598
    • 2021-08-24
    121 min

    [FTDSS-003]Legendary Scout Who Sent 10,000 Women To The AV Industry Nietzsche of Kabukicho Dirty Instincts, Super Sex 3 videos + 1 Cum Yoko Tsukasa.

  • yoko tsukasa censoredFTDSSfalenonietzsche in kabukichofalenotubeFTDSS-003FTDSS0031ftdss00003
    • 2021-08-26
    268 min

    [SVDVD-873]Shame! New Female Teachers That Just Got Their Teaching Certificates Get Physical Examinations With Male Teachers By Doctors And Nurses At Men"s Hospital. 2021

  • yuzu shirakawa miyazaki ri censoredcreampiebig titsSVDVDsadistic villageistshy girlSVDVD-873SVDVD8731svdvd00873
    • 2021-09-09
    125 min

    [DLDSS-027]You Were The One Person Who I Didn"t Want Finding Out About My Secret ... That Day, When My Big Sister Came To Tell Me That She Was Going To Get Married, Her Face Was Filled With Love And Happiness, But The Truth Was That I Had Just Go

  • ayaka tomoda censoredcreampiesingle workDLDSSdahliasho saigoDLDSS-027DLDSS0271dldss00027
    • 2021-09-12
    15 min

    10musume 091221_01 Secret Pussy Collection: Yui Asakawa 2

  • amateur uncensored10musume
    • 2021-09-17
    58 min

    230OREC-884 Meru

  • amateur censoredcreampiebig titsorecorec-884orec884230orec-884
    • 2021-10-16
    130 min

    [AVSA-182]These Wicked Women Vowed To Get Revenge, So We Used Aphrodisiacs To Get Them Hooked On Sex Churin Nakazawa

  • chuzawa nakazawa censoredsingle workAVSAavsariari sanpeiavscollectorsAVSA-182AVSA182avsa00182



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online