s m u




FC2CESDHODVEBODDASDCHRVATIDWANZAUKSSHKDSSISMIDEVEMAGMEMAWDSPRDAUKGJULDTTMILKSDAB

2020-09-25
81 min

[sqb-068]あいら

  • amateur censoredcreampiebig titssqbsqb-068sqb068sqb-068
    • 2020-10-11
    31 min

    S-Cute if_015_01 If I could spend Halloween with Aoi-Jiangshi / Aoi

  • amateur censoredamateurcosplayifif-015if015if-015-01
    • 2020-10-11
    121 min

    [SQTE-336]There's Nothing To Do Except Fuck In A Small Town During The SUmmer! Aoi Kurugi/Ai Kawana

  • aoi kururugi ai kawana censoredbeautiful girlSQTEs cuteSQTE-336SQTE336sqte00336
    • 2020-11-06
    120 min

    [SSNI-907]Flesh Fantasy x Fleshy Fantasy NTR A Cute And Chubby Girlfriend With Colossal Tits Is Getting Your Friend's Big Meat Pressed Into Her Pussy With Sweaty Sex And You Can't Say A Thing About It Shion Yumi

  • evening beauty censoredbig titssingle workSSNIs1 no 1 stylejo asagiriSSNI-907SSNI907ssni00907
    • 2020-11-06
    95 min

    483HMHM-001 [Bin erection nipple beautiful breasts 86F] [Resort raw squirrel wet and fluffy 2nd round] [Whitening boobs too god bikini gal and on the road! ] [Infinite climax M constitution] [Meat x Saddle x Meat x Saddle x Dessert] Man’s romanc

  • amateur censoredamateurhmhmhmhm-001hmhm001483hmhm-001
    • 2020-11-06
    60 min

    [PARATHD-3026]Voyeur Footage Of Adult Massage Parlor Popular With Mature Women (6): Watch Them Go Wild With Pleasure As The Secret Massage Techniques Get Their Pussy Juices Overflowing

  • censoredcreampieblowjobPARATHDparadise tvPARATHD-3026PARATHD3026parathd03026
    • 2020-11-13
    150 min

    [MDBK-140]Miniskirt Thong S********l 2

  • kome himeno yui satonaka censoredcreampieuniformMDBKbazookak taroMDBK-140MDBK140h-1496mdbk00140
    • 2020-11-13
    151 min

    [SCPX-409]That Delinquent Girl Who Used To Bully Me Back In School Is Now A Call Girl! If You're Truly Sorry, You'll Let Me Fuck You Bareback!!

  • censoredcreampieSCPXscoopmousouzokuSCPX-409SCPX409h-565scpx00409
    • 2020-11-27
    49 min

    FC2PPV 1585608 [No / piece] “… I can only do it here ♡♡” This is a dream !？ Miku-chan in uniform and a legal student Saddle !!! This time I went up the stairs of another adult for the first time in my life. * There is an appearance rev

  • amateur uncensoredfc2
    • 2020-12-02
    61 min

    [KBTV-047]Are Girls Who Go To Bars Full Of Guys By Themselves Just Waiting To Get Picked Up？ We Find Out!

  • censoredbig titsamateurKBTVmessy tvKBTV-047KBTV047h-1514kbtv00047
    • 2020-12-04
    60 min

    Caribbeancom 120420-001 Naked House Wife : No Hair Lady Is Always Horney As Naked Miyuki Sakura

  • miyuki sakura uncensoredcreampiecaribbeancom
    • 2020-12-06
    127 min

    [SORA-284]Passionate French Kiss Fucks - Dripping Wet With My Fuck Buddy In The Open Air Mai Kamisaki

  • kamisaki mai censoredsingle workSORAyama to sorahimu lockSORA-284SORA284sora00284
    • 2020-12-08
    483 min

    [KTRA-263]Getting Naughty With My Stepdaughter 10 Girls, 8 Hours, 2 Discs

  • asami tsuchiya yui kasugano censoredbeautiful girlKTRAk tribeKTRA-263KTRA263h-094ktra00263
    • 2020-12-14
    25 min

    FC2PPV 1606407 Limited to 300 pieces [Individual shooting] Prefectural general course ③ Karate beautiful girl. First time 〇

  • amateur uncensoredfc2
    • 2020-12-20
    91 min

    [OAE-205]Deep Impact - Hana Arisuka

  • arisu aka censoredsingle workOAEaircontrolzampaOAE-205OAE205oae00205
    • 2020-12-21
    153 min

    [FCDC-125]This Alluring Secretary Has Erect Nipples And A Small Waist And Likes To Lure The Employees To Temptation Because, After All, She's A Horny Slut Hotaru Mori

  • hotaru mori censoredslutsingle workFCDCweekenderFCDC-125FCDC125fcdc00125
    • 2020-12-22
    57 min

    FC2PPV 1607293 [Lori] Moe (18) Club activities! The pure heart girl of the second stage of Kendo is super moody and lewd ☆ Estrus in the car! I grabbed the cock with my cute hand holding a bamboo sword and fellatio in the back of my throat. Thrust wi

  • amateur uncensoredfc2
    • 2020-12-31
    63 min

    345SIMM-586 Beautiful Breasts Young Wife Enjoys Creampie 3 Times According To Home Cheating Video

  • amateur censoredcreampiemarried womansimmsimm-586simm586345simm-586
    • 2021-01-09
    51 min

    C0930 hitozuma1344 Nana Tokutaka 27years old

  • amateur uncensoredc0930
    • 2021-01-16
    239 min

    [HUNTA-932]She Brought A Video Camera Along On Our First Date To Remember It By, But When We Got Grabbed By A Couple Of Street Toughs They Used It To Record Fucking Her. I Was So Scared I Couldn't Move A Muscle...

  • censoredcreampieHUNTAhunterspace nyanjirohhh groupHUNTA-932HUNTA932hunta00932
    • 2021-01-24
    120 min

    [AGAV-047]This Natural Airhead Lolita Babe Has The Greatest I-Cup Colossal Tits I Oiled Up This Fully Clothed Princess' Titties And Satisfied Myself From All Angles And Now My Life Is Complete Hana Himesaki

  • himesaki hana censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-047AGAV047agav00047
    • 2021-01-25
    234 min

    [MJBB-001]Girls From The Minato Ward: Arrogant Girls With Sopping Wet Pussies From The Minato Ward - POV Video

  • censoredbig titsamateurMJBBminato ward girlsMJBB-001MJBB001h-1554mjbb00001
    • 2021-02-04
    94 min

    [AKDL-083](For Guys Who Want Girls To Step On Their Faces) All POV! Extreme Smells! Teased By Foot Sole Fragrances

  • kohara kihara ami kirishima censoredAKDLaquinorishrikenaknrAKDL-083AKDL0831akdl00083
    • 2021-02-06
    102 min

    [ADN-297]Please Forgive Me Dear... A Lost Girl's Memories 4 - Yuri Sasahara

  • yuri sasahara censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-297ADN297adn00297
    • 2021-02-12
    171 min

    [XRW-980]Big Titted Married Woman, Aphrodisiac Confinement And Cumming Yuri Honma

  • really censoredcreampiebig titsXRWreal worksani nakamurareal real worksXRW-980XRW980172xrw00980
    • 2021-02-12
    79 min

    [ZOZO-037]姫野かんな先生

  • censoredZOZOsadie willenauZOZO-037ZOZO0371zozo00037
    • 2021-02-16
    137 min

    [SDDE-644]Room Boundaries x NTR - This Entire Family Is Mine To Do As I Please, Heh Heh Heh! -

  • yui hatano yurika censoredcreampiebig titsSDDEsod createryo inugamisenzSDDE-644SDDE6441sdde00644
    • 2021-02-27
    154 min

    [CLUB-630]The Routine Of A Horny Married Woman Who Brings In Young Men And Seduces Them With Her Huge Breasts

  • censoredbig titsslutCLUBhentai shinshi clubCLUB-630CLUB630club00630
    • 2021-03-01
    121 min

    [NACR-398]Hold Me... The Single Mother Who Fell In Love With Her Neighbor Mitsuha Higuchi

  • mitsuha higuchi censoredcreampiesingle workNACRplanetdirector oshichidomeNACR-398NACR398h-237nacr00398
    • 2021-03-04
    488 min

    [AKDL-092]We Found 4 Pretty Working Girls In Town With Sensitive Bodies Who Just Happen To Be Subs! Risa, Age 26, Works In Publishing/Kanon, Age 24, Works For An Office Supplies Distributor/Kana, Age 25, Construction Company Clerk/Yukina, Age 24, Rec

  • rio okita nakajo cano censoredsquirtingAKDLaquinoriaquinoriaknrAKDL-092AKDL0921akdl00092
    • 2021-03-05
    198 min

    [PLY-005]Camping With Gals Mana Hirano/Aori Arihoshi

  • mana hirano aori arisei censoredsquirtingPLYplay entertainmentplayPLY-005PLY005h-1557ply00005
    • 2021-03-25
    177 min

    [SW-766]Sexy Study Time With S********ls - Exploring Growing Girls' Bodies Until They're Ready For A Perfect 100 Score! Moaning After A Few Touches, These Sensitive Amateur Girls' Tight Pussies Get Wet And Eager To Learn How Cock Feels Al

  • censoredamateurSWswitchswitch switchSW-766SW7661sw00766
    • 2021-03-26
    170 min

    [WAAA-042]If You Can Withstand Yuzu Shirakawa's Ultimate Techniques She'll Let You Fuck Her Raw!

  • yuzu shirakawa censoredcreampieblowjobWAAAwanz factorywanzWAAA-042WAAA042waaa00042
    • 2021-04-01
    121 min

    [AMBI-123]Perverted Step Dad's Sex Toy Beautiful Y********l In Uniform Has Her Relationship With Her Boyfriend Ruined Suzu Monami

  • monami bell censoreduniformschoolgirlAMBIplanet plusdirector oanbibaresotsuAMBI-123AMBI123h-237ambi00123
    • 2021-04-26
    55 min

    [083PPP-2126]デリヘルNo.1盗●！(53)～長野で南アルプスの天然美女とハメたい！

  • amateur censoredamateurpppppp-2126ppp2126083ppp-2126
    • 2021-05-05
    133 min

    [GVH-227]Dual Anal Sluts 8 - Rui Hizuki / Hana Kano

  • rui hizuki kanna flower censoredslutGVHglory questtorindoru tanakaGVH-227GVH22713gvh00227
    • 2021-05-09
    61 min

    HEYZO 2518 Pissing MILF Really Loves Anal Drilling – Mikako Tachibana

  • amateur uncensoredcreampieheyzo
    • 2021-05-28
    121 min

    [MIAA-444]Teaching A Super Impertinent Brat A Lesson By Grabbing Her And Fucking Her Hard Ichika Matsumoto

  • ichika matsumoto censoredcreampiedeepthroatMIAAmoodyzsuisei akaieveryone s porn starMIAA-444MIAA444miaa00444
    • 2021-06-04
    176 min

    [SSIS-087]Amateur No. 1 Style Ren Hirose Porn Debut

  • hirose lotus censoredbeautiful girlsingle workSSISs1 no 1 styleusa pyonSSIS-087SSIS087ssis00087
    • 2021-06-05
    74 min

    476MLA-008 A neat and clean beauty is 〇 in a row and she consents to appear in the AV! ？？ What is the content of the diet program monitor that you can get a reward？

  • amateur censoredcreampiesquirtingmlamla-008mla008476mla-008
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-17
    119 min

    [HMN-013]I Can't Say Much About Popular New Idols, but this Real Idol who Won't Tell Me the Name of Her Group Gets a Vaginal Creampie in her AV DEBUT!! Miya Shindo.

  • shindo miya censoredcreampiesingle workHMNhon nakatiger kosakaiHMN-013HMN013hmn00013
    • 2021-07-17
    149 min

    [JUL-654]On A Business Trip, I Have To Share A Bed With My Lady Boss Who I've Always Wanted？! Hitomi Honda

  • honda hitomi censoredmature womansingle workJULmadonnaunicorn fukudaJUL-654JUL654jul00654
    • 2021-07-24
    240 min

    [HUSR-240]The Country With The Most Beautiful Women In The World! Special Collection Of The Ultimate Weapons From Russia, The Kingdom Of Beauties! Who Ever Knew Russia Had Such Amazing Women？!

  • isabel clark ibana censoredcreampiebig titsHUSRbig mocalbooker thustleHUSR-240HUSR24057husr00240
    • 2021-07-25
    17 min

    FC2PPV 1939347 [Individual Shooting] Ordinary Course Black Hair Big Breasts ③ Ignorant Girl, Unwanted Pregnancy, Abortion Compensation Creampie To Two Uncles

  • amateur uncensoredfc2
    • 2021-07-29
    87 min

    435MFC-128 [Advocacy Body That You Want To Protect] Excited By The Fair-Skinned Slender Saffle And The First Gonzo! All-You-Can-Eat With Vaginal Cum Shot Sex And Cosplay Sex To Commemorate The Virginity Of Gonzo! [Shiroto Gonzo ＃ Rei ＃ 23 Years Old ＃

  • amateur censoredcreampieamateurmfcmfc-128mfc128435mfc-128



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online