slut censored housewife mature woman jav




FC2MILKLULUAUKGSPRDAMBIMEYDAWDDASDFSDSSATIDMARAVEMASQTEHODVAUKSCJODSANNGODBLKSSIS

2021-01-09
44 min

C0930 ki210109 Request

  • amateur uncensoredc0930
    • 2021-01-22
    48 min

    [BTH-110]All Holes Available: A Cum Dumpster Miho Nakazato

  • miho nakazato censoredcreampieBTHchobitchchovicBTH-110BTH110h-1435bth00110
    • 2021-02-01
    302 min

    [DOKS-535]Super-Sensitive Pussy! These Sluts Can't Handle It When Their Boxes Get Licked - Cunnilingus Best Collection 30 Girls, 5 Hours

  • alice hayase natsuki hasegawa censoredschoolgirlamateurDOKSoffice k sDOKS-535DOKS53536doks00535
    • 2021-02-02
    40 min

    475SKCK-019 Kaname 1

  • amateur censoredamateurbdsmskckskck-019skck019475skck-019
    • 2021-02-11
    131 min

    [SPRD-1377]My Brother's Wife - Her Body And Mind Call Out To Be Loved - Touko Namiki

  • namiki touko censoredmature womansingle workSPRDtakara eizohotate ikkanaleddinSPRD-1377SPRD137718sprd01377
    • 2021-02-22
    131 min

    [AGAV-048]S*****t Teacher With Beautiful Pale Skin And Juicy Colossal Tits Devours Teachers. The School Is In Total Disorder With Clothed Sex Happening Every Day. Yume Natsuki

  • natsuki yume censoredbig titsslutAGAVsexyoshida greatAGAV-048AGAV048agav00048
    • 2021-02-24
    48 min

    FC2PPV 1699616 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] ♥ ️ Raw Gonzo to former Tsundere maid ♥ ️ Massive vaginal cum shot! !! ♥ ️ * Review benefits / facial expression masturbation ♥

  • amateur uncensoredfc2
    • 2021-02-26
    60 min

    328HMDN-340 [Oni cock x married woman] White milk whip whip boyne! Devilish bust 100cm! Hcup Boobs Mama Rie-san 38 years old (pseudonym) The pheromone BODY that captivates men one after another is the best! Cuckold seeding with erotic areola & se

  • amateur censoredcreampiebig titshmdnhmdn-340hmdn340328hmdn-340
    • 2021-03-08
    94 min

    460SPCY-016 [18 years old Saitama Prefecture] Rei

  • amateur censoredcreampieamateurspcyspcy-016spcy016460spcy-016
    • 2021-03-14
    68 min

    492MERC-270 A beautiful girl in light clothes is on the porch …

  • amateur censoredcreampieamateurmercmerc-270merc270492merc-270
    • 2021-03-25
    123 min

    [FSDSS-192]Raised Bad To Be Good! Rebellious Sex With Tomboyish Step Sister Sora Shiina

  • shiina sky censoredsistersingle workFSDSSfalenoseijoui ishiifaleno starFSDSS-192FSDSS1921fsdss00192
    • 2021-03-25
    230 min

    [SUN-009]Cum Guzzling Perverted Nutritionist Sucks Dick With Her Long Tongue

  • moe kominato censoredbig titssingle workSUNsunSUN-009SUN00913sun00009
    • 2021-03-25
    12 min

    FC2PPV 1740261 Until 27 [Uncensored] A fair-skinned simple girl who came to Tokyo. Staying continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-01
    49 min

    10musume 040121_01 Perverted easy girl who became a hyper groovy Kumi Tsukino

  • amateur uncensored10musume
    • 2021-04-01
    120 min

    [NACR-412]Sex With A Married Woman Carrying Breast Milk, Impatient At Her Abstinence - Hinami Narisawa

  • hinami narusawa censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-412NACR412h-237nacr00412
    • 2021-04-09
    120 min

    [MIDE-911]Barely Legal Runaway Tied Up For Ravishment - Breaking In A Confined Teen From Dawn Till Dusk For Days Sakura Miura

  • minamata sakura censoredbig titssingle workMIDEmoodyzmoodyz divaMIDE-911MIDE911mide00911
    • 2021-04-09
    59 min

    345SIMM-631 [Loss of virginity with a child I’ve always liked] This is a man’s dream! I got on that girl I longed for and got vaginal cum shot twice with my first sex! !! !!

  • amateur censoredcreampieamateursimmsimm-631simm631345simm-631
    • 2021-04-09
    239 min

    [MUKD-461]Brand New Discovery: 10 Innocent Barely Legal Teens! 240 Minutes Of All New Footage! Beautiful Y********l In Uniform Takes It All Off To Fulfill Her Carnal Desires - Their First Bare Naked Dildo Masturbation

  • censoredschoolgirlbeautiful girlMUKDmukuMUKD-461MUKD461mukd00461
    • 2021-05-08
    157 min

    [MDBK-177]A Complete POV Little Stepsister Style Maid Delivery Health Call Girl Service Cums With A Shaved Pussy Creampie Option 4

  • ichika matsumoto chiharu miyazawa censoredcreampiecosplayMDBKbazookaMDBK-177MDBK177mdbk00177
    • 2021-05-15
    141 min

    [SORA-312]She Transforms Into A Slut After School! S********l With H-Cup Tits Loves To Expose Herself Ena Koume

  • ena koume censoredbig titsschoolgirlSORAyama to sorausubashisuiSORA-312SORA312sora00312
    • 2021-05-21
    147 min

    [HND-984]She Just Cheated On Her Brand New Boyfriend... But Only Because She Wanted To Get Better At Sex For Him, She Swears! Slut With Short Hair Makes Her Creampie Debut! Rina Uchida

  • rina uchida censoredblowjobbeautiful girlHNDhon nakausa pyonHND-984HND984hnd00984
    • 2021-06-12
    121 min

    [APKH-176]A Sex Trip Where I Was Invited By Miss Campus, A Girl With Super Hard, Beautiful Nipples. The Sexual Service I Got At This Hot Springs Resort Made My Love Juices Flow Out In Thin Strings Karen Asahina

  • karen asahina censoredcreampiesingle workAPKHaurora project annexhaurora project anexAPKH-176APKH176apkh00176
    • 2021-06-17
    120 min

    [KSBJ-142]My Son's Wife Is A Total Slut... Yuha Kiriyama

  • kiriyama yuu censoredcreampiemarried womanKSBJksb kikaku emmanuellebito sakuraKSBJ-142KSBJ142
    • 2021-06-25
    72 min

    FC2PPV 1887779 ＃ 65 Natsu: Smile, personality, gestures, all too cute. Creampie aiming for a safe day for TV personalities. [Personal shooting] [Gonzo] [High image quality]

  • amateur uncensoredfc2
    • 2021-07-10
    181 min

    [SQIS-054]180 Minutes Of Filthy Footage (Video)

  • censoredbig titsmature womanSQISfa proSQIS-054SQIS054sqis00054
    • 2021-07-15
    39 min

    413INST-139 [Sexual Spring] Omanko Full Bloom ★ First Creampie Video Now Doki Mecha Kawa Female College Student Get! Portio Is Pierced By The First Aphrodisiac Cock And Demon Convulsions Acme! 19-year-old Best Body Conceived With Whole Body And Ejacu

  • amateur censoredcreampieamateurinstinst-139inst139413inst-139
    • 2021-08-15
    64 min

    KOUKAI-058 Ten

  • amateur censoredcreampieamateurkoukaikoukai-058koukai058koukai-058
    • 2021-08-21
    64 min

    383REIW-088 Noa

  • amateur censoredcreampiebig titsreiwreiw-088reiw088383reiw-088
    • 2021-09-04
    120 min

    [NKD-280]The Fresh Face Takes It, Mugi Shinonome

  • shinonome mugi censoredsingle workNKDnakashima kougyoukanamoriNKD-280NKD280nkd00280
    • 2021-09-09
    120 min

    [DLDSS-025]"Hey, I Want To Taste Your Cock." She Doesn"t Comply. A Beautiful Lewd Girl In A Peaceful Workplace. Suzume Mino

  • suzume mino censoredbig titsblowjobDLDSSdahliakei isoiDLDSS-025DLDSS0251dldss00025
    • 2021-09-10
    115 min

    [JUL-706]Lonely In My Fishbowl Life. Iori Nanase

  • iori nanase censoredcreampiebig titsJULmadonnainaballJUL-706JUL706jul00706
    • 2021-09-11
    52 min

    H0930 ki210912 Ikue Katahira 47years old

  • amateur uncensoredh0930
    • 2021-09-30
    101 min

    FC2PPV 2272808 [Individual Shooting 56] Complete Appearance 20 Years Old Legal Loli Pie Bread Serika ④ Cleaning Blowjob From Continuous Vaginal Cum Shot After Outdoor Exposure

  • amateur uncensoredfc2
    • 2021-10-01
    119 min

    [CAWD-286]My Stepsister"s Nipple Fetish And Intimacy Led Me To Fucking Her Until I Ran Out Of Semen, Starring Moko Sakura

  • sakura moko censoredsluthandjobCAWDkawaiinikusonCAWD-286CAWD286cawd00286
    • 2021-10-09
    129 min

    [BAHP-088]Unexpected Hotel Meet-up. 145cm H-cup! She Offers A Sexy Slender Body With Big Tits! Tons Of Hard Fucking That Makes Her Tits Jiggle And Shake! Rika Aimi

  • rumi tadami censoredcreampiebig titsBAHPbarutanyoshida daibutsuhoppinBAHP-088BAHP088bahp00088
    • 2021-10-14
    101 min

    [XMOM-036]BUKKAKE The Really Masochistic Wife, Eri Takigawa

  • eri takigawa censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-036XMOM036h-086xmom00036
    • 2021-10-15
    121 min

    [FOCS-026]The Discovery Of A Genius!？ She"s Living Life And Enjoying Every Second LOL Even A Delayed Ejaculator Will Immediately Cum When She Whips Out Her Tongue Techniques And Get You Sensitized To The Max With A Perfect And Explosively Fast Co

  • miku kurusu censoredbig titsblowjobFOCSabc mousou zokufocusFOCS-026FOCS026focs00026
    • 2021-10-15
    124 min

    [VOD-004]A Real Amateur Housewives Document No.2 During Those Few Hours Before Her Husband Comes Home ... Her H-Cup Big Tits Are Lustily, Alluringly, Sweatily, Bouncing For Joy, During Creampie Sex Rie Matsuo

  • rie matsuo censoredcreampiebig titsVODvenustamatsuka bingoreality venusVOD-004VOD004vod00004
    • 2021-10-28
    55 min

    H4610 ki211028 Ayako Miyazumi 26years old

  • amateur uncensoredh4610
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-05
    175 min

    [SSIS-233]深夜残業NTRR 大嫌いな初老上司の逸物が相性抜群だなんて… 三宮つばき

  • sannomiya tsubaki censoredbig titssingle workSSISs1 no 1 stylenikusonSSIS-233SSIS233ssis00233
    • 2021-11-28
    41 min

    FC2PPV 2469652 Introducing A 100 Pure Beautiful Girl! Insanely Cute Looks, Voice Like A Voice Actor, Almost Completely Taken Off In The Car In The Daytime, Window Fully Opened And No Hand Blow Job To Heaven

  • amateur uncensoredfc2
    • 2021-12-03
    120 min

    [MIAA-538]She Hates Her Slovenly Boss, But She Couldn"t Turn Down His Relentless Titty Tweaking ... And He Gave This Female Employee A Compulsory Creampie While She Kept On Cumming As He Fondled Her Erect Nipples Misono Mizuhara

  • suwon miso censoredcreampiebig titsMIAAmoodyzhata tairyouminna no kikatanMIAA-538MIAA538miaa00538
    • 2021-12-17
    156 min

    [JUNY-054]Reverse 3P Snack Bar Where 2 Slutty Sisters WIth Collosal Tits Ravage The Customers! Misono Mizuhara Julia Yoshine

  • suwon miso yoshine yuria censoredbig titsslutJUNYfitchnikuyokuJUNY-054JUNY054juny00054
    • 2021-12-17
    41 min

    480FRIN-063 [60 Years Old Kinshicho Store] Hidden Camera Raw Sex Video Of A Mature Masseuse

  • amateur censoredcreampiemarried womanfrinfrin-063frin063480frin-063
    • 2021-12-17
    44 min

    FC2PPV 2522121 [Appearance] [Uncensored] [First Shot] 19-Year-Old Active Student Yua-Chan. Beer Seller Part-Time Job Stuffy Dirty Pussy Entwined With Sticky Meat Folds And Stiff Uncle Cock Almost On The Verge Of Strikeout, Yellowish Dirty Aged Uncle

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online