sunburn javcensored jav creampie censored




FC2WAAAMEYDMVSDSTARSHNDATIDCAWDKSBJMILKBLKEBODGMEMNGODNACXVENUDTTSSISPPPDLULUSHKD

2020-11-08
20 min

10musume 110820_01 An Amateur Girl Had Peeing Cuz She Got Excited Eri Hasegawa

  • amateur uncensored10musume
    • 2020-11-10
    82 min

    FC2PPV 1564878 * 1st place commemoration * [Individual / uncensored] 20-year-old neat and clean girl has a continuous vaginal cum shot for the first time in her life. Refilling ♥ [Amateur, outflow strictly prohibited

  • amateur uncensoredfc2
    • 2020-11-18
    30 min

    [CSDX-001][VR] Cosplay & Kaho Shibuya

  • kaho shibuya censoredbig titssquirtingCSDXcrystal picturecosdeluxeCSDX-001CSDX00149csdx00001
    • 2020-12-05
    120 min

    [SHKD-915]I'll Never Forget The Man Who Ravished Me... Hijiri Maihara

  • kiyoshi maihara censoredSHKDattackerstakuo otanideath night evilSHKD-915SHKD915shkd00915
    • 2020-12-10
    194 min

    [HAWA-232]A Cuckold Investigation "It Was Supposed To Be An Anniversary Filming Of A Married Couple Having Sex, But Instead It Turned Into A Surrogate Fuck Fest..." When This Horny Wife Keeps Getting Her Pussy Plugged By Another Man's Coc

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-232HAWA2321hawa00232
    • 2020-12-24
    132 min

    [IESP-672]Ready For Lesbian - My Stepsister's In Love With Me Honoka Tsujii

  • tsujii honoka yui hatano censoredbig titslesbianIESPienergykikuriniespIESP-672IESP6721iesp00672
    • 2020-12-27
    56 min

    [oretd-825]Tsumugi

  • amateur censoredcreampieuniformoretdoretd-825oretd825oretd-825
    • 2021-01-01
    60 min

    HEYZO 2428 Discrete Maid Is Ready For Naughty Care Vol.11 – Emi Aoi

  • emi aoi uncensoredcreampieblowjobheyzo
    • 2021-01-02
    69 min

    [KBTV-055]Married Woman Shows A Different Face Than In Front Of Her Husband Mrs. Misato

  • censoredmarried womanamateurKBTVclass s amateurKBTV-055KBTV055h-244kbtv00055
    • 2021-01-12
    241 min

    [GONE-028]SPIDER KIJYOI PORN STAR

  • maki kyoko kiriyama yuu censoredcreampieblowjobGONEmercurya fair skinned elder sisterGONE-028GONE028h-1133gone00028
    • 2021-01-15
    54 min

    [EMOI-043]Going To Tokyo, Picking Up Guys And Making Them Lose Their Virginity. I Told You Osaka Girls Were Hot. Tsukino Nonomiya/An Erotic Girl.

  • tsukino nonomiya censoredbig titsEMOIsod createtiger gavelemo girlEMOI-043EMOI0431emoi00043
    • 2021-02-06
    42 min

    C0930 hitozuma1347 Sonomi Hijiri 27years old

  • amateur uncensoredc0930
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    51 min

    [orec-695]白鳥

  • amateur censoredcreampiebig titsorecorec-695orec695orec-695
    • 2021-02-12
    183 min

    [MIAA-390]Older Guys Make Such Strange Noises When You Tease Their Nipples - Let's Shut Them Up With A French Kiss! Taunting Little Temptresses Use Their Tongues During Tantalizing Sex Ruka Inaba Kanon Kanade

  • inaba kanon kanon censoredbig titsschoolgirlMIAAmoodyzgoemoneveryone s porn starMIAA-390MIAA390miaa00390
    • 2021-02-21
    119 min

    [CAWD-177](A Teacher Must Never Commit Herself To Pure Love) She Couldn't Ignore The Needs Of Her Male S*****t, And When He Tickled Her Maternal Instinct, One Night, During A Typhoon, They Hungrily Feasted Upon Each Other Until They Destroyed Eve

  • maiyuki ito censoredcreampiesingle workCAWDkawaiisuisei akaiCAWD-177CAWD177cawd00177
    • 2021-02-26
    86 min

    [MBRBM-014]Feels Like Summer - Natsuki

  • natsuki censoredbig titssingle workMBRBMnctrMBRBM-014MBRBM0145141mbrbm00014
    • 2021-03-05
    118 min

    [HEZ-263]Kyoto Housewife Makes Her Anal Debut At 59! Kyoko Aikawa

  • kyoko aikawa censoredsquirtingmature womanHEZhot entertainmenthatake rihotHEZ-263HEZ26359hez00263
    • 2021-03-06
    115 min

    [RBK-006]Servant Colored Stage Extra: Anal Creampie Show Reiko Kobayakawa

  • kobayakawa reiko censoredanalsingle workRBKorga blackusubashisuiRBK-006RBK006rbk00006
    • 2021-03-11
    63 min

    [orec-710]みなみん

  • amateur censoredcreampiebig titsorecorec-710orec710orec-710
    • 2021-03-12
    68 min

    [YMDS-023]Street Corner Snapshot #TokyoMaskBeauties (Miku 22 Years Old Freelancer)

  • censoredamateurYMDSmomotaro video publishinghimrockyoung peachYMDS-023YMDS023ymds00023
    • 2021-03-18
    119 min

    [TPPN-186]Hot Newcomer's First Descent Into Porn! First Time Light Skin Amateur Takes Loads Of Cum On The Face As She Writes And Screams In Sexy Pleasure 11 Cum Shots

  • censoredamateurbukkakeTPPNteppanTPPN-186TPPN186tppn00186
    • 2021-03-19
    65 min

    FC2PPV 1733170 [Race Queen Highleg x Super Glossy Pantyhose] <4K Shooting> Tall slender body pantyhose leg line beauty & biting pussy is too erotic!Fully dressed fuck obscenely by shifting the highleg with a perverted leotard !!

  • amateur uncensoredfc2
    • 2021-03-19
    271 min

    [DNW-113]Male Porn Star's Contact Book 14 Amateur Girls Hunting Season! 31

  • censoredcreampiebig titsDNWprestigedocument nowDNW-113DNW113118dnw00113
    • 2021-03-20
    50 min

    FC2PPV 1734645 [First shot / graduation commemoration] Legal J who came to Tokyo from the Sanyo region ● Cum 5 barrage Cum swallowing Tokyo story 2 Momo

  • amateur uncensoredfc2
    • 2021-03-21
    65 min

    476MLA-029 [I cup huge breasts] Ginza hostess is a tide splash! !! A devilish woman who contributes 800,000 brand bags to a large customer is incontinent ⇒ Pride collapses! Demon Pis climax where the Sui Cup rotates at high speed like an amusement pa

  • amateur censoredsquirtingamateurmlamla-029mla029476mla-029
    • 2021-03-21
    74 min

    490FAN-073 Yuri

  • amateur censoredcreampiebig titsfanfan-073fan073490fan-073
    • 2021-03-24
    92 min

    241GAREA-505 Mayo-chan

  • amateur censoredbig titsamateurgareagarea-505garea505241garea-505
    • 2021-03-27
    248 min

    390JAC-083 [First and last God times SP! !! !! ] 240 minutes of a miracle where delusions collide with each other! !! When metamorphosis meets each other … A new erotic world is born! !! W live with Fantastic 69! W Blow competing for Ji ● Po! Re

  • amateur censoredcreampiebig titsjacjac-083jac083390jac-083
    • 2021-03-29
    43 min

    362SCOH-038 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [De ● Zi] Miori Ayaba

  • amateur censoredcreampiebig titsscohscoh-038scoh038362scoh-038
    • 2021-04-01
    141 min

    [ID-030](Beloved Escort) I Ordered An Escort Who Normally Works As A C***dcare Worker (Cute) Momo Watanabe Momoka Watanabe

  • ruri kuribayashi ayaka tomoda censoredcosplayIDplumposter rawgunzshirouto only plumID-030ID0305521id00030
    • 2021-04-04
    67 min

    SIRO-4453 [First shot] [Slender beauty] [Bounce your body up to the geki piss ..] A slender beauty who learns calligraphy at art school appears. Distort the face as well as her model with pleasure and flush the whitening naked body .. AV application

  • amateur censoredamateursirosiro-4453siro4453siro-4453
    • 2021-04-17
    175 min

    [CAWD-211]Real Life College Girl With A Bright Smile Nozomi Kitajo 19 Years Old Kawaii* Exclusive Debut

  • nozomi kitajo censoredsquirtingbeautiful girlCAWDkawaiikyoseiCAWD-211CAWD211cawd00211
    • 2021-05-04
    66 min

    FC2PPV 1801416 * Limited to 2 days 6000 ⇒ 1980pt ★ First shot premiere ♥ Geki Kawaro Bishoujo ♥ Inexperienced undeveloped BODY ♥ Meruchi 20 years old ☆ Soft beauty big tits ♥ Electric blame Iki ♥ Raw vaginal cum shot in an innocent pussy with outstan

  • amateur uncensoredfc2
    • 2021-05-07
    237 min

    [IDBD-842]It's Too Good! My Balls Are About To Burst! Best Of Top Class Beautiful Sluts Licking And Teasing Your Nipples Without Mercy

  • kana momonogi akari tsumugi censoredbeautiful girlslutIDBDidea pocketidea pocket bestIDBD-842IDBD842idbd00842
    • 2021-05-14
    179 min

    [SSIS-075]Fresh Face NO.1 STYLE: Konan Sayoi AV Debut

  • koyoi konan censoredbig titssingle workSSISs1 no 1 stylemon cSSIS-075SSIS075ssis00075
    • 2021-05-15
    114 min

    [VEC-475]A Secret Between Me And My Friend's Mother. I Had Creampie Sex With This Older Woman... Nanao Nakano

  • nanao nakano censoredcreampiebig titsVECvenussarumegami venusVEC-475VEC475vec00475
    • 2021-05-28
    102 min

    [YSN-548]My New Sister-in-Law Is A Total Slut But My Dick Won't Stop Getting Hard Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcreampieslutYSNnonYSN-548YSN548h-127ysn00548
    • 2021-05-30
    71 min

    345SIMM-644 Attack-loving S Girl J ○ Rides Uncle In Cowgirl With Pan Pan! Rin-chan, who is good at teasing and irritating, holds the initiative and Ji-ko, and uncle Tajitaji www Of course, everything is because of love ♪ I love it, so I’m crazy

  • amateur censoredcreampieuniformsimmsimm-644simm644345simm-644
    • 2021-06-01
    120 min

    [NACR-424]The Wife Next Door With Giant Tits Accidentally Entered The Wrong House Yuri Honma

  • really censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-424NACR424h-237nacr00424
    • 2021-06-12
    60 min

    383REIW-073 Maya

  • amateur censoredcreampieamateurreiwreiw-073reiw073383reiw-073
    • 2021-06-16
    119 min

    [TPPN-195]Age 20: You Aren't The Same As You Were Yesterday. Your Adult Lusts Unleashed, Carnal Instinct Ready To Go Wild For Screaming Orgasms!

  • censoredblowjobbeautiful girlTPPNteppanTPPN-195TPPN195tppn00195
    • 2021-07-03
    140 min

    [PKPT-001]Studio Apartment Documentary Making Love All Day In A Small Room With K-Cup Hana Haruna

  • haruna hana censoredcreampiebig titsPKPTfuck group and fun friends daydreamersPKPT-001PKPT001pkpt00001
    • 2021-07-20
    180 min

    [KAZK-064]Fooling His Stepmother And Letting His Friend, A Massage Therapist, Give Her A Sexual Massage...180 Minutes

  • censoredmomKAZKstar paradisefamilyKAZK-064KAZK064h-254kazk00064
    • 2021-09-01
    128 min

    [DKWT-017]AV Journey Showcasing Gorgeous Biracial Wife Who Enjoys Extraordinary Masturbation And Then Demands Real Dick. Karina Nishida

  • nishida karina censoredcreampiesquirtingDKWToffice k swakadzumaDKWT-017DKWT01736dkwt00017
    • 2021-09-03
    110 min

    [ADN-342]The Uncontrollable Passion Of My Wife Who Lost Her Feelings Of Pleasure, Michiru Kujo

  • kujo michiru censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-342ADN342adn00342



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online