that hoshimiya




FC2NACRADNSQTEAUKGABWMIDVVEMAKBIAVSAVENXCAWDFSDSSMEYDMIDENATRMILKPREDAUKGCHRVAWD

2020-12-10
92 min

[XMOM-026]I Love You. But I Also Like Big Hard Cocks That Belong To Strangers. Chisato Shoda

  • shota chisato censoredcreampiemarried womanXMOMcenter villagemurakipink breathXMOM-026XMOM026h-086xmom00026
    • 2020-12-11
    123 min

    [DIC-080]Under 5' Tall! Busty G-Cup Voice Actress Hina Shinjo's Porn Debut! Prim, Pretty G-Cup! Real Anime Body

  • hina shinjo censoredbig titssingle workDICprestigekyohei nemuridiscoverDIC-080DIC080118dic00080
    • 2020-12-12
    166 min

    [FFFS-023]Picking Up MILFs! Horny Mature Sluts Caught On Camera 20 - Tall Girls! Colossal Tits! Two Wild Nympho Wives Edition - Prim, Pretty 40-Year-Old Nagisa, I-Cup, 5ƌ" - Curvy 38-Year-Old Saki, L-Cup, 5Ǝ", Takes A Creampie

  • censoredcreampieslutFFFSmature woman private videos emmanuellemanji groupFFFS-023FFFS023fffs00023
    • 2020-12-23
    21 min

    FC2PPV 1617022 Do you have any more beautiful girls？ The best beautiful girl appeared at the end of this year! !! Starbucks clerk Mai-chan! !! Finally decided to appear!

  • amateur uncensoredfc2
    • 2020-12-25
    59 min

    [WKD-037]Fallen Woman June Lovejoy

  • june lovejoy censoredslutsingle workWKDwaap entertainmentk westwWKD-037WKD0372wkd00037
    • 2020-12-27
    42 min

    H4610 ki201229 Ren Aoyama 25years old

  • amateur uncensoredh4610
    • 2021-01-29
    12 min

    FC2PPV 1663712 Until 1st 1480pt → 1180pt [Personal shooting] Slender young wife’s underwear is put on and taken off in the kitchen and raw insertion cum shot NTR

  • amateur uncensoredfc2
    • 2021-02-02
    66 min

    FC2PPV 1669624 [First time limited 1980] Beautiful big breasts natural G cup ❤️ Fair-skinned Echiechi body ❤️ Pile driving piston ❤️ Massive vaginal cum shot in a very narrow pussy ❤️ * Review privilege “Semen exploitation with intense handjob w

  • amateur uncensoredfc2
    • 2021-02-11
    138 min

    [IESP-676]Suzu Monami: Lesbian Unleashed - I Fell In Love With My Step-sister

  • monami bell toua kotone censoredlesbiandramaIESPienergykikuriniespIESP-676IESP6761iesp00676
    • 2021-02-17
    118 min

    [GVH-193]This Slut Love Exhibitionism, G*******gs, And Bukkake! Amu Hanamiya

  • hanamiya amu censoredslutsingle workGVHglorythin bladeGVH-193GVH19313gvh00193
    • 2021-02-19
    98 min

    [VENX-010]My Stepmom Just Started Working At A Soapland Brothel So She Made Me Her Practice Partner Ayano Fuji

  • ayano kato censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-010VENX010venx00010
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-28
    68 min

    FC2PPV 1706220 PREMIERE ＃ 6 G-cup nursery teacher and child-making training. Vaginal cum shot & butt shot & vaginal cum shot.

  • amateur uncensoredfc2
    • 2021-03-03
    39 min

    S-Cute if_016_06 She wants to spear / Chiharu

  • chiharu censoredamateurdramaifif-016if016if-016-06
    • 2021-03-11
    15 min

    HEYZO 2476 A Titty Fuck with Reiko – Reiko Mizuhara

  • reiko mizuhara uncensoredhandjobcumshotheyzo
    • 2021-03-27
    62 min

    1Pondo 032721_001 Great Shooting: Reina

  • amateur uncensored1pondo
    • 2021-04-01
    120 min

    [NACR-410]I Was Obsessed With The Breasts Of My Stepmom Miki Matsuzaka

  • miki matsuzaka censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-410NACR410h-237nacr00410
    • 2021-05-04
    103 min

    FC2PPV 1801647 First shot ♥ ️ Complete appearance ♥ ️ Professional student 20 years old who looks good with long hair ♥ ️ Devoted blowjob & raw etch first experience of fair-skinned beautiful girl with beautiful legs & nice ass ♥ ️ The vaginal

  • amateur uncensoredfc2
    • 2021-05-10
    38 min

    498DDH-014 [NTR] Sleeping a brown slender gal with pink hair in front of her boyfriend … A friend and her girlfriend who got drunk by drinking at home and fell asleep [Voyeur]

  • amateur censoredamateurbeautiful girlddhddh-014ddh014498ddh-014
    • 2021-05-28
    121 min

    [WAAA-065]Shooting Cum Inside Of Her After She's Already Orgasmed! Moa Maeda

  • maeda momoko censoredcreampiebig titsWAAAwanz factorywanzWAAA-065WAAA065waaa00065
    • 2021-05-29
    120 min

    [KSBJ-139]My Son-in-law's Pranks Are Escalating Shuri Yamaguchi

  • yuri yamaguchi censoredbig titsblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-139KSBJ139ksbj00139
    • 2021-06-15
    62 min

    SIRO-4550 [First shot] [Beautiful ass beauty] A beautiful office lady who fascinates a lascivious body has appeared. Beautiful naked body sweating with tension, moisten it violently .. AV application on the net → AV experience shooting 1562

  • amateur censoredamateursirosiro-4550siro4550siro-4550
    • 2021-06-16
    121 min

    [OVG-173]My Aunt Came To Visit Me In The Hospital And Carelessly Accidentally Flashed Her Tits, Giving Me An Instant Huge Erection! Auntie Takes Full Responsibility By Riding Me Cowgirl Style And Milking Me Of Every Last Drop Of Cum

  • yui hatano yuri sugawa censoredcreampiebig titsOVGglory questOVG-173OVG17313ovg00173
    • 2021-07-03
    120 min

    [MEAT-033]Amazing Ass: Record Of Adultery - A Celebrity Wife Who Likes To Be Filmed - Sumire (32)

  • censoredMEATbig fleshy road family daydreamMEAT-033MEAT033meat00033
    • 2021-07-06
    62 min

    422ION-0071 The sound college student who looks neat and graceful was actually lewd!

  • amateur censoredschoolgirlamateurionion-0071ion0071422ion-0071
    • 2021-07-31
    57 min

    HEYZO 2577 Orgasms With A Horny Pussy Girl Vol.20 – Nana Kamiyama

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-08-11
    59 min

    500DPL-0025 AV Debut Of Creampie Girls In Science Girls While Enrolled In Six Universities!

  • amateur censoredcreampieamateurdpldpl-0025dpl0025500dpl-0025
    • 2021-08-24
    36 min

    509JPAK-014 [In Amateur Life] Private Sex Fellatio Best With Arisa-Chan In Uniform Girls

  • amateur censoredcreampieschoolgirljpakjpak-014jpak014509jpak-014
    • 2021-08-31
    58 min

    KOUKAI-059 T-chan (Hasumi Takashi)

  • amateur censoredcreampieschoolgirlkoukaikoukai-059koukai059koukai-059
    • 2021-09-02
    64 min

    FCP-038 [Delivery Only] Muchipuri Best Ass Job! !! ＃ 2 I’ll Make You Feel Good With My Big Ass …! !!

  • amateur censoredamateurslutfcpfcp-038fcp038fcp-038
    • 2021-09-10
    116 min

    [DASD-916]Gorgeous Stepmom And Step-daughter. Stepmom Meets Up With Step-daughter After Decades Apart. Minami Hatsukawa. Tsubaki Kato

  • hatsukawa minami kato camellia kaoru natsuki censoredcreampiemature womanDASDdaschinpo dazaiDASD-916DASD916dasd00916
    • 2021-09-25
    130 min

    [BLOR-177]Friendly Girl With Big Tits Gets Soaked With Raging Dick and Drools And Cums!

  • censoredbig titsBLORburokkori mousou zokubroccoliburokkoriBLOR-177BLOR177blor00177
    • 2021-09-25
    150 min

    [SCPX-433]Voyeur Video: Married Women Naked And Filmed At The Chiropractor *Incredible Orgasms!*

  • censoredcreampieSCPXk m producehasshiscoop kmpSCPX-433SCPX433scpx00433
    • 2021-10-09
    40 min

    FC2PPV 2319991 Infiltrate A Secret Orgy ㊳ A Cool Beauty Beauty With Sharpness ♥ S A Lot Of Characters And Ossans Are Also Tajitaji W Finally, Masturbation Instructions In Front Of You ♪ * High Quality Version & Review Benefits Included ♥

  • amateur uncensoredfc2
    • 2021-10-09
    181 min

    [SQIS-059]Girls Who Do It With Their Stepparents, Vol. 2. I...Have Sex With My Stepfather.

  • censoredbig titsmature womanSQISfa pro platinumfa proSQIS-059SQIS059sqis00059
    • 2021-10-16
    119 min

    [USBA-036]A Middle-Aged Teacher Received Some Relentless Breaking In Training From A Devilish Beautiful Girl Natsu Tojo

  • natsu tojo censoredschoolgirlbeautiful girlUSBAavsusubashi suiavscollectorsUSBA-036USBA036usba00036
    • 2021-10-29
    47 min

    SKHO-014 Sora (Sora Inoue)

  • amateur censoredcreampieschoolgirlskhoskho-014skho014skho-014
    • 2021-11-19
    121 min

    [HMN-086]The Secret Face Of My Boss That Only I Know. 200 Days Since Our Amazing French Kiss Creampie After The Date Where She Teased My Dick With A Blowjob So Good I Felt Stupid HR: Head Ms. Yumika Yumi Saeki

  • yuka saeki censoredcreampieblowjobHMNhonnakarassha miyoshiHMN-086HMN086hmn00086
    • 2021-11-25
    130 min

    [STARS-452]経理のまひろちゃんは、SNSで絶倫チ〇ポたちを集める性獣ビッチだった。 唯井まひろ

  • tadai mahiro censoredSTARSrakudarakudasod createSTARS-452STARS452
    • 2021-12-04
    140 min

    [BAHP-095]My Friend Works At An Adult Video Label, And He Asked Me, "Hey, Can I Use Your Place To Do Some Filming？ This Video Will Cum With Special Features, Like You Can Fuck A Famous Adult Video Actress All You Want." And That"s How He

  • natural mizuki censoredbeautiful girlslutBAHPbaltandaibutsu yoshidahoppinBAHP-095BAHP095bahp00095
    • 2021-12-20
    34 min

    FC2PPV 2533020 [Personal shooting / set sale] Big breasts that seem to be comfortable to hold and have a good personality ① & ②

  • amateur uncensoredfc2
    • 2021-12-31
    123 min

    [ADN-366]I Decided To Give My Ovulating Sister-in-law Creampie Sex In Place Of My Broke And Destitute Older Brother. Tsumugi Akari

  • akari tsumugi censoredcreampiesingle workADNattackersdragon nishikawaotona no dramaADN-366ADN366adn00366
    • 2022-01-04
    62 min

    [010422-001]BOGA x BOGA: Riri Shiraki Praises Me

  • riri shiraki uncensoredcreampiehandjobcaribbeancom
    • 2022-01-28
    119 min

    [ADN-374]I Found Out My Wife"s Sister Wants Me, So We Fucked Like Crazy Behind Her Back Starring Mako Iga

  • iga mako censoredcreampiebeautiful girlADNattackerskitorune kawaguchiotona no dramaADN-374ADN374adn00374
    • 2022-01-31
    31 min

    FC2PPV 2635824 First Shot! !! Limited Number [Uncensored] A New Esthetician Who Is A Friend Of A Beauty Receptionist At A Certain Beauty Salon! !! Creampie Twice On The Sensitive Body Of The Slender Body! !! I Wonder If All The Women In That Beauty T

  • amateur uncensoredfc2
    • 2022-02-11
    115 min

    [KAM-100]Amateur NTR Posting: I Slept With My Son"s Wife, Secretly Filmed It, Then Uploaded The Video Online For All To See - Naughty Father-In-Law Creampies His Busty Daughter-In-Law

  • censoredcreampiebig titsKAMkarmamanji groupKAM-100KAM100kam00100



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online