tsumugi




FC2STARSWAAAMILKHDKAGVHAWDABWATIDSSNISHKDSPRDNATRVEMAMIDENNPJRBDJUFEMIDVWANZONEZ

2020-09-10
96 min

[AKDL-047](At Work NTR) Infidelity Footage Of Beautiful Married Coworker Fucking After Being Tempted During Working Hours Yumi Saeki Ka

  • yuka saeki censoredamateursingle workAKDLakinoriakinoriaknrAKDL-047AKDL0471akdl00047
    • 2020-09-16
    124 min

    [GVH-123]Breaking In At A Celebrity Girls' School - Kaho Imai

  • natsuho imai censoredschoolgirlslutGVHglory questtorindoru tanakaGVH-123GVH12313gvh00123
    • 2020-09-25
    481 min

    [MBM-215]Autumn Married Pussy Festival - Amateur Sluts With Big Tits Drive Guys Crazy 30 Girls, 8 Hours

  • censoredbig titsamateurMBMprestigegaro sasazukambmMBM-215MBM215118mbm00215
    • 2020-10-03
    95 min

    [RBD-990]The House Where She Lives - Sara Kagami, Yuria Toda

  • kagami sara yuria toda censoreddramaRBDattackersnagira kenzoryupakuRBD-990RBD990rbd00990
    • 2020-10-07
    60 min

    345SIMM-524 Yuki-chan / 18 years old / Imadoki J ● The contents are naughty even with a beautiful black-haired girl

  • amateur censoredcreampieuniformsimmsimm-524simm524345simm-524
    • 2020-10-08
    93 min

    [OKP-069]A Divine Office Lady In Glasses Hibiki Otsuki This Office Lady Wears Suits And Glasses And Wraps Her Beautiful Legs In Pantyhose And Now You Get To Enjoy Her, Fully Clothed, From The Soles Of Her Feet To Her Toes! Enjoy Face-Sitting And Foot

  • otsuki sound censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-069OKP0691okp00069
    • 2020-10-22
    104 min

    [SPRD-1339]A Stepmom Comes Up And Gets A Creampie From Her Stepson - Emi Enda

  • emi toda censoredcreampiemature womanSPRDtakara eizokyuta tukumoaleddinSPRD-1339SPRD133918sprd01339
    • 2020-11-01
    61 min

    AVHD-100 Reona

  • amateur censoredbig titsamateuravhdavhd-100avhd100avhd-100
    • 2020-11-01
    235 min

    [ARAN-008]An Orgasmic Sexual Beast, Called A Married Woman A Picture Scroll Of Cruel, Orgasmic, Ripe Honey Pot Pleasure These Pieces Of Prey Are Crying Insane Tears Of Tantalizing Ecstasy As They Await Execution INFERNO BABE ULTRA FILM

  • censoredbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-008ARAN008aran00008
    • 2020-11-06
    33 min

    [BTH-083]If You Cum On My Face, My Husband Will Find Out... So At Least, Cum In My Mouth Riko Miyase

  • riko miyase censoredmarried womanbukkakeBTHchobitchchovicBTH-083BTH083h-1435bth00083
    • 2020-11-12
    225 min

    [PIYO-094](For Streaming Editions Only, Cums With Bonus Footage) "Even If It's Us Against The World, I'll Always Protect You" Experience Days Of Crazed Love And Adultery, Filled With The Impregnations Of His S*****ts Through Creampie

  • censoredcreampieslutPIYOhyokopiero dabicchiPIYO-094PIYO0941piyo00094
    • 2020-11-17
    50 min

    1Pondo 111720_001 Braless Neighbor In The Morning: Yuki Shinoda

  • amateur uncensored1pondo
    • 2020-11-28
    61 min

    1Pondo 112820_001 Great Shooting: Mika Fujimura

  • amateur uncensored1pondo
    • 2020-12-01
    130 min

    [NACR-372]Horny MILFs Ayaka Makimura

  • ayaka makimura censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-372NACR372h-237nacr00372
    • 2020-12-20
    118 min

    [CAWD-152]When She's Had Liquor, Look Out! She'll Leap On Any Guy's Dick She Sees And Drain His Balls Dry... This Extreme Slut Won't Take No For An Answer. Mayuki Ito

  • maiyuki ito censoredcreampieslutCAWDkawaiikyoseiCAWD-152CAWD152cawd00152
    • 2020-12-20
    120 min

    [DASD-785]Hot Steamy Sex With Dripping Sweat And Love Juices Betraying Their Desires. - High-Quality Edition - Eimi Fukada

  • emi fukada censoredbig titssingle workDASDdashajime yanaiDASD-785DASD785dasd00785
    • 2020-12-30
    28 min

    FC2PPV 1625049 Year-end and New Year limited [Individual shooting] Prefectural general course ③ Girl who is Gonzo before Xmas for her boyfriend

  • amateur uncensoredfc2
    • 2021-01-05
    62 min

    SIRO-4382 [First shot] [I love the back of the vagina] [Traceful luster blowjob] Professional student who is curious about naughty things. If you feel like you’re sick of stimuli other than masturbation after a long time and keep knocking on the

  • amateur censoredamateursirosiro-4382siro4382siro-4382
    • 2021-01-13
    39 min

    230ORE-747 Mako-san

  • amateur censoredcreampieamateuroreore-747ore747ore-747
    • 2021-01-21
    213 min

    [DANDY-747]It's great fucking a serious woman ! Neat and Clean Looking Nurse Turns out to be a Crazy Slut vol. 4

  • censoredblowjobslutDANDYdandymongolian sanoDANDY-747DANDY7471dandy00747
    • 2021-01-22
    118 min

    [HZGD-175]I Started To Lust For My Colleague's Wife, And When I Could No Longer Resist, And Grabbed Her Tight, She Lusted For Me Too And Placed Me Under Confinement And Fucked My Brains Out As She Pleased ... . Yuria Satomi

  • satomi yuria censoredcreampiebig titsHZGDmarried woman flower garden theaterzampaimage married woman flower garden theatHZGD-175HZGD175h-1100hzgd00175
    • 2021-01-25
    30 min

    FC2PPV 1659473 [Personal shooting] Unfaithful act of a 26-year-old young wife with an erotic plump body ①

  • amateur uncensoredfc2
    • 2021-02-06
    112 min

    240TOKYO-407 Narumi

  • amateur censoredamateurcosplaytokyotokyo-407tokyo407240tokyo-407
    • 2021-02-06
    42 min

    FC2PPV 1675283 * Uncensored * Dental hygienist’s popular model Arina-chan Part3 Gorgeous 2 shots ♡ M man bullying in raw squirrel + oiran figure without being able to suppress during massage

  • amateur uncensoredfc2
    • 2021-02-28
    60 min

    413INST-100 Big Breasts Daughter Mayu-chan (18) A large amount of squirting is blamed by two Aniki ☆ Forcibly insert a raw dick into Mayu Chan who can not resist because it is too tight! Jerky cramping acme on the waist cramping piston ☆ Alternately

  • amateur censoredbig titsamateurinstinst-100inst100413inst-100
    • 2021-03-13
    24 min

    FC2PPV 1724979 [Beautiful girl’s wall! The first price revolution! ] When you cosplay, you switch on. .. .. [S-ki beauty, Ka-chan debuts! ] Suddenly sperm was squeezed out with a total of 3 shots from the blow job

  • amateur uncensoredfc2
    • 2021-03-19
    87 min

    383REIW-040 Kanon

  • amateur censoredbig titsamateurreiwreiw-040reiw040383reiw-040
    • 2021-03-30
    61 min

    HEYZO 2491 Orgasms With A Horny Pussy Girl Vol.16 – Mai Amao

  • mai amao uncensoredcreampiehandjobheyzo
    • 2021-04-06
    135 min

    [KTRA-289]Beautiful Girl, No Pulling Out - Urara Kaon

  • kanon urara censoredcreampiesoloworkKTRAk tribeKTRA-289KTRA289
    • 2021-04-07
    66 min

    474MUSUME-003 Himari Part1

  • amateur censoredsquirtinguniformmusumemusume-003musume003474musume-003
    • 2021-04-11
    47 min

    HEYZO 2497 I Love Sex! PTM Fuck With A Fuckster! – Yu Nagata

  • yu nagata uncensoredcreampieheyzo
    • 2021-04-21
    54 min

    481SACZ-019 Airi 3

  • amateur censoredamateurbdsmsaczsacz-019sacz019481sacz-019
    • 2021-05-02
    66 min

    200GANA-2483 Seriously Nampa, first shot. 1630 A slender beauty whose boyfriend has posted a Gonzo video on the net! Mr. Mutsuri, who looks mature and loves H, can not refuse the lascivious request … Pay attention to the beautiful ass with the s

  • amateur censoredamateurganagana-2483gana2483200gana-2483
    • 2021-05-08
    208 min

    [BAZX-289]The Creampie Idol Sleeps Her Way To The Top vol. 015

  • censoredcreampieuniformBAZXbazookatodoBAZX-289BAZX289bazx00289
    • 2021-05-14
    240 min

    [SKMJ-165]If You Can Resist The Good Looking AV Actor's Super Sex Techniques You Get 1 Million Yen! If You Cum, Get Ready For A Merciless Quick And Fast Pounding With A Raw Creampie! College Girls Around The Town Faint From Massive Pleasure Sprea

  • censoredcreampiebig titsSKMJred face girlone topSKMJ-165SKMJ165h-1324skmj00165
    • 2021-05-22
    167 min

    [DGCEMD-011]*Delivery Only! Bonus Video Included* 5 Seconds Before The Cock Breaks! A Full-course Slut Who Doesn't Hold Her SEX Back - Honoka Tsujii

  • tsujii honoka censoredbig titsblowjobDGCEMDcelebrity friendsDGCEMD-011DGCEMD011dgcemd00011
    • 2021-06-04
    86 min

    483SGK-027 [Neat and clean sensitive pastry chef] [Beautiful back, beautiful constriction, nice ass! ] [Tall 169 cm transcendent erotic good body] [Set his Kusless frustration] [Crying climax] Sexless with my boyfriend living together for 4 months! A

  • amateur censoredbig titsamateursgksgk-027sgk027483sgk-027
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-25
    182 min

    [JUFE-301]Specializing In Men's Nipples! Sensitive Clit Nipples Fainting In Ecstasy Salon Ranka

  • ranka censoredcreampiebig titsJUFEfitchJUFE-301JUFE301jufe00301
    • 2021-07-01
    121 min

    [CLOT-019]Pantyhose Temptation - Karen Otoha

  • karen otoha censoredcreampiesingle workCLOTplanet plusdirector ocloseCLOT-019CLOT019h-237clot00019
    • 2021-07-08
    112 min

    [ZEAA-063]Wild Sex With My French Kiss Service Wife Yumi Saeki ka

  • yuka saeki censoredcreampiemarried womanZEAAcenter villagesky cloudsthe pole center villageZEAA-063ZEAA063h-086zeaa00063
    • 2021-07-21
    154 min

    [DGCEMD-036]*Limited Edition Includes Bonus Footage* Nonstop Orgasms Bring Tears To Her Eyes 11, Starring Yui Hatano

  • yui hatano censoredcreampiemature womanDGCEMDcelebrity friendsDGCEMD-036DGCEMD036dgcemd00036
    • 2021-08-01
    126 min

    300MIUM-731 [The Strongest Boobs Musou] Rent A Gcup Nurse Sister As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying A Date In Yokohama, Have A Rich Love Lover Sex At Th

  • amateur censoredcreampiebig titsmiummium-731mium731300mium-731
    • 2021-08-14
    99 min

    300MAAN-685 [Do M Make Her Cuckold And Fuck] Super Obedient De M Constitution That Makes You Feel Ordered! !! Sex In The Brush Down Raw That The Movement Of The Waist Does Not Stop At The Virgin Ji ○ Port Of Gatchigachi! !! → Horse Riding Blowjob &am

  • amateur censoredcreampieamateurmaanmaan-685maan685300maan-685
    • 2021-08-14
    120 min

    [KSBJ-151]A Son"s Wife Was A Slut By Nature... Michiru Kujou.

  • kujo michiru censoredcreampieslutKSBJksb kikaku emmanuellesakura ninKSBJ-151KSBJ151ksbj00151
    • 2021-09-03
    122 min

    [ADN-344]The Story Of How The Woman I Hired Gave Me A Super Erotic Blowjob Iroha Natsume

  • natsume saiharu censoredblowjobsingle workADNattackersdoragon nishikawaotona no dramaADN-344ADN344adn00344



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online