variety sister censored javcensored def




FC2DASDCHRVLULUHZGDROYDHNDSHKDAPODVEMASQTEGMEMSTARSHMNSSISNATRMARANACRGVHPPPDAWD

2018-06-07
140 min

[HAWA-143]The Abnormal Everyday Existence Of A Married Woman Who Lives An Unofficial Love Life With Her Little Brother Too "I Love Both My Husband And My Little Brother" Lena-san 30 Years Old

  • censoredmarried womanamateurHAWAcosmos videonagase hawaiicosmos video soft on demandHAWA-143HAWA1431hawa00143
    • 2018-06-07
    157 min

    [IENE-899]I'm A Loser, But My Big Tits Big Sister Said, "I'll Let You Rub Your Cock Up Against Me," And Made Me Promise Only To Grind, But We Both Started To Feel So Good, And Her Pussy Was Dripping Wet, So My Dick Just Slipped Right

  • censoredcreampiebig titsIENEi energyie nergyIENE-899IENE8991iene00899
    • 2018-06-07
    143 min

    [IENE-897]Are You Trying To Tempt Me With That Ass？! Seeing My Sister-In-Law's Sexy Rear End Is Too Much Stimulation For A Boy Of My Age. I Just Had To Stick It Inside!

  • censoredcreampieslutIENEi energybambino puddingie nergyIENE-897IENE8971iene00897
    • 2018-06-07
    147 min

    [NHDTB-137]Opening The Door To The Bath, He Sees His Neat and Clean Big Sister Naked And Pissing! Seeing His Sister's Pussy For the First Time, This Horny Little Brother Lunges Into Forbidden Incest With Her, Unable To Restrain Himself. 4

  • censoredbig titsblowjobNHDTBnatural hightanaka baconNHDTB-137NHDTB1371nhdtb00137
    • 2018-06-07
    165 min

    [SDMU-842]An Underwear Company Is Designing A New Range Of Sporty Lingerie. Three Competitive Female Employees Volunteer Themselves As Models, Leading To A Raunchy Presentation In Underwear...

  • asahi mizuno ai sena censoredlingerieSDMUsod createSDMU-842SDMU842
    • 2018-06-07
    97 min

    [GS-190]A New Phenomenon Has Been Happening: Girls Are Getting Horny And Causing A Chain Reaction At School And Getting Seductive And Fucking Their Brains Out!？ My Friend's Big Sister Got Her First Whiff Of A Young Boy In A Long While, And That S

  • censoredschoolgirlsisterGSsosoru garconsweet chestnut pasteGS-190GS1901gs00190
    • 2018-05-24
    148 min

    [SW-558]My Friend's Older Sister And MILF Mama Have Been Luring Me To Temptation By Flashing Panty Shot And Titty Shot Action At Me, And Now My Cock Is On The Verge Of Exploding But They Keep On Teasing Me With Pull Out Sex And It's Driving M

  • censoredbig titsSWswitchyocchanswitch switchSW-558SW5581sw00558
    • 2018-05-24
    101 min

    [HBAD-422]I Was In A Closed Room With My Wife's Young Sister And Now She's Trying To Muffle Her Screams Of Pleasure While A Middle Aged Man Furiously Thrusts His Cock Into Her Pussy Hikari Misumi

  • hikari mizusumi censoredbig titssisterHBADhibinomamezawa mametarobabeHBAD-422HBAD4221hbad00422
    • 2018-05-24
    243 min

    [SDMU-823]Cherry Boy Little Brother Touches His Mature Older Sister's Body And Gets Hard Even Know He Knows Its Wrong, Will It Turn Into "Forbidden Incest" Or What？! 8

  • censoredsisterSDMUsod createyazawa spikeSDMU-823SDMU8231sdmu00823
    • 2018-05-11
    188 min

    [SCOP-511]This Beautiful Instructor Was Strangely Up Close And Personal In The Way She Taught At This Private Computer Class, And When I Could No Longer Resist, I Just Let My Erection Pop Up, And Then She Began To Lure Me To Temptation And Secretly L

  • censoredcreampieSCOPscoopthis is taroSCOP-511SCOP511h-565scop00511
    • 2018-05-11
    128 min

    [VRTM-353]Someone Hid Her Clothes While She Was Bathing! She Desperately Hid Her Body With Just A Towel But Her Little Brother Could Still See Her Pussy Peeking Out, And Now His Lust Was In Full Force, As He Grabbed Her Ass And Inserted Himself For S

  • aya miyazaki hamazaki mao censoredcreampiesisterVRTMv r produceyamanaka socksVRTM-353VRTM353h-910vrtm00353
    • 2018-05-10
    225 min

    [NHDTB-124]"Let's Take A Bath Together Like Old Times" Said My Big Sister As She Invited Me To A Lotion Lathered Bath I Lost My Mind In Slick And Slippery Pleasure As We Got Up Close And Personal In Hot Pissing Sex

  • censoredblowjobsisterNHDTBnatural highsakurai vanillaNHDTB-124NHDTB1241nhdtb00124
    • 2018-05-10
    119 min

    [SDDE-538]Winner Of 3 Michelin Stars An Organic Restaurant In Minami Aoyama

  • kanna misaki sakisui censoredSDDEsod createshinya kimurasenzSDDE-538SDDE5381sdde00538
    • 2018-05-03
    140 min

    [DOHI-069]My Sister And Her Friends Were Afraid To Get Caught, So We Quietly Fucked In Shame... We Know It's Wrong, But We Can't Stop Our Lust! Fully Satisfying Creampie Sex And We Absolutely Can't Tell My Little Sister

  • sena ai asada yuri censoredcreampiesquirtingDOHIoffice k sonigara gonzaburoinsertDOHI-069DOHI06936dohi00069
    • 2018-04-26
    343 min

    [IENE-883]An 18 Year Anniversary Special I'm A Loser With The Ladies And My Schoolgirl Little Sister Took Pity On Me And Said, "You Can Only Rub Your Dick Against My Pussy" And Made Me Promise Only To Pussy Grind Her, But We Both Started

  • censoredcreampieschoolgirlIENEi energyie nergyIENE-883IENE8831iene00883
    • 2018-04-12
    189 min

    [NHDTB-111]When I Was In Hospital I Couldn't Count On My Mom To Satisfy My Sexual Urges, So I Asked My Mother In Law When She Came To See Me, And She Was Nice Enough To Ride Me Cowgirl And Let Me Cum In Secret 16 Creampie Specials

  • censoredcreampieblowjobNHDTBnatural highlemon heart nakajimaNHDTB-111NHDTB1111nhdtb00111
    • 2018-04-12
    120 min

    [SW-551]This Slutty Elder Sister Intentionally Entered This Adult Entertainment Shop By Mistake! She Kept Flashing Panty Shot Action In This Tiny Store, And Shoved Her Ass Against My Rock Hard Cock Over And Over Again And Teased Me With Pull Out Acti

  • censoredslutSWswitchdragon nishikawaswitch switchSW-551SW5511sw00551
    • 2018-04-06
    128 min

    [DOHI-068]Hellish Blowjob Punishment! When This Woman Was Caught Shoplifting, Instead Of Apologizing, This Steely Bitch Threw A Temper Tantrum, So She Got A Deep Throat Rape So Hard She Was Dribbling Cum From Her Mouth! And While She Was Still In Sho

  • amami heart komachi coffee censoredcreampieschoolgirlDOHIoffice k sonigara gonzaburoinsertDOHI-068DOHI06836dohi00068
    • 2018-03-21
    136 min

    [SDMU-796]My Big Sister's Fragrance Incest Videos Of 3 Sisters And Brothers In The Moment Of Forbidden Insertion Mayu, 25 Years Old Nene, 25 Years Old Yoko, 25 Years Old

  • censoredcreampiesisterSDMUsod createkomatsu 17.comet shootSDMU-796SDMU7961sdmu00796
    • 2018-03-21
    172 min

    [NHDTB-108]This Big Sister Was Forbidden To Move A Muscle And Forced To Become Human Furniture While Enduring Orgasmic Torture With A Strapped-On Vibrator

  • censoredsquirtingblowjobNHDTBnatural highhopeless dynanaNHDTB-108NHDTB1081nhdtb00108
    • 2018-03-09
    120 min

    [SCOP-496]This Gal Was Wearing A Hoodie At Home But Not Wearing A Bra Or Panties And Totally Had Her Guard Down!! Even Though They Were Brother And Sister, He Couldn't Control His Lust And In the End They Had Incest: Creampies Sex!!

  • censoredcreampiesisterSCOPscoopcomet akaiSCOP-496SCOP496h-565scop00496
    • 2018-03-08
    138 min

    [MIST-200]Pregnancy Fetish Incest A Little Sister Who Was Turned Into A Cum Bucket By Her Big Brother

  • nanami yua censoredcreampiesisterMISTmr michiruMIST-200MIST2001mist00200
    • 2018-03-08
    137 min

    [MIST-201]The Total Domain Of My Sister and Her Friends In Knee High Socks And Having Creampie Raw Footage Sex!

  • ai miyaji miyu saito censoredcreampieMISTmr michirusaitaMIST-201MIST2011mist00201
    • 2018-02-08
    195 min

    [IENE-863]We Found This Amateur Elder Sister In Shinjuku And She Was Giving A Gentle Cherry Popping When This Cherry Boy Started Furiously Pumping Her With His Cock And Made Her Cum Over And Over Instead

  • censoredcreampieIENEi energyie nergyIENE-863IENE8631iene00863
    • 2018-01-12
    153 min

    [TEM-067]My Nosy But Beautiful Big Sister-In-Law Barged In While My Wife Was Away! She Likes To Meddle So Much That She'll Do Anything, So Maybe I Can Have Creampie Sex With Her Too!？

  • chika aso tokunaga rei censoredcreampiebig titsTEMprestigetemptationTEM-067TEM067118tem00067
    • 2018-01-12
    218 min

    [VRTM-319]"I Want A Baby!" This Big Titty Nursery School Teacher Is Going To Her Male Colleague For Advice! But She Wants A Baby So Bad, That Her Maternal Instincts Take Over And She Gives Him A Handjob! And Now She's Begging His Young Co

  • kirishima sakura hamazaki mao censoredcreampiebig titsVRTMv r producevincent galVRTM-319VRTM319h-910vrtm00319
    • 2017-12-21
    310 min

    [IENE-847]A 17th Year Anniversary Special I'm A Loser, And My Big Sister Felt Sorry For Me, And Offered To Pussy Grind Me If I Would Promise Just To Grind, But Then It Just Felt So Good That Her Pussy Was Dripping Wet! And Then My Cock Just Slipp

  • censoredcreampiesisterIENEi energyie nergyIENE-847IENE8471iene00847
    • 2017-12-16
    190 min

    [GAPL-008]This Big Tits MILF And Big Sister Are Bouncing And Jiggling Their Massive Titties, Showing Off Their Cleavage, And Luring My Friend To Temptation Like A Slut And Making Him Into A Mother/Daughter Sandwich

  • censoredbig titsmilfGAPLgreen applehhh groupGAPL-008GAPL008gapl00008
    • 2017-11-16
    232 min

    [IENE-838]Picking Up Girls: Amateur Action We Found This Brother And Sister In Shinjuku Who Looked Like A Loving Couple, And We Asked Them To Take The Saran Wrap Pussy Grinding Challenge

  • censoredamateursisterIENEi energyIENE-838IENE8381iene00838
    • 2017-11-02
    146 min

    [IENE-834]I Was Pulling Pranks On My Sleeping Schoolgirl Little Sister, But Then She Started Demanding A Raw Fuck, And I Wanted To Unload My Cum, But She Locked Her Legs Around Me In A Crab Hold And Kept Me There Until I Had To Creampie Her!

  • censoredcreampieschoolgirlIENEi energyie nergyIENE-834IENE8341iene00834
    • 2017-08-01
    182 min

    [SW-499]I Suddenly Ended Up With 3 Big Titty Sisters! I Was An Only Child, But When My Dad Got Remarried To A Lady With 3 Daughters, We Were Now One Big Family Living Under One Roof... I Knew Nothing About Women, But These Big Tits Slutty Sisters Gav

  • censoredbig titsslutSWswitchyocchanswitch switchSW-499SW4991sw00499
    • 2017-07-20
    132 min

    [SDMU-648]This Cherry Boy Little Brother Knows It's Wrong To Get His Dick Hard But When He Touches His Big Sister's Ripe And Ready Body, He Can't Help Getting Erect, So Will He Commit The "Forbidden" Act Of Incest!？ Up Close And P

  • censoredsisterSDMUsod createcamelSDMU-648SDMU6481sdmu00648
    • 2017-07-06
    100 min

    [SDMU-638]My Little Sister's Smell Momo(My Little Sister, A Schoolgirl) A Video Record Of A Big Brother Getting Hooked On His Little Sister's Tiny Pussy

  • censoredschoolgirlslutSDMUsod createsatoshi morikawaSDMU-638SDMU6381sdmu00638
    • 2017-06-15
    115 min

    [SDMU-618]She Looks Prim And Proper But Naughty Rumors Follow Her Wherever She Goes x [Real Creampie Extreme Bus Tour] We Get To The Bottom Of Our New Hire Using Top Tier Actresses And Large Orgies In Her Spectacular Debut! Rookie Assistant Director

  • censoredSDMUsod createcaptain gangwonsod female employeeSDMU-618SDMU6181sdmu00618
    • 2017-06-15
    160 min

    [MIST-163]At A Well-Established Titty Bar In Japan's Largest Shopping District, A Rookie Hostess Steals A Veteran Call Girl's Customer And Secretly Fucks Him. Without A Condom. 8

  • sakisaka hanakoi narumi sayaka censoredbig titsMISTmr michiruMIST-163MIST1631mist00163
    • 2017-02-02
    119 min

    [FSET-679]His Sister-In-Law Jokingly Teased Her Brother-In-Law, And Now He Was Rock Hard And Erect! Enjoy As He Mercilessly Pounds Her Pussy In An Orgasmic Betrayal Fuck!？

  • otsuki sound freedom censoredmarried womanmature womanFSETaquinorik baknrFSET-679FSET6791fset00679
    • 2016-12-22
    141 min

    [SDDE-466](Always Fucking) Bikini Massage 5

  • censoredSDDEsod createhiroshi sasakurasenzSDDE-466SDDE4661sdde00466
    • 2016-12-22
    244 min

    [SDDE-469]Work of a Cock Cleaner 15

  • censoredSDDEsod createeasy matsumotosenzSDDE-469SDDE4691sdde00469
    • 2016-11-11
    299 min

    [VRTM-212]My Little Sister Has Grown Into A Woman With Big Tits, And Now She's Batting Eyes At Me To Gently Lead Me To Creampie Temptation The Best Of All Wishes Cum True! 4 Girls 5 Hours 8 Creampie Cum Shots!

  • hitomi inoue mako kanno censoredcreampiebig titsVRTMv r produceiwanagaVRTM-212VRTM212h-910vrtm00212
    • 2016-11-10
    135 min

    [SDMU-404]Question for Amateur Magazine Models Yearning for TV Fame: "How Far Would You Go For Your Dream？"

  • censoredamateurSDMUsod createdemolitionSDMU-404SDMU4041sdmu00404
    • 2016-09-08
    186 min

    [SW-433]I Thought Frottage Sex Wasn't Supposed To Be Real Sex! If You Move Your Hips Like That Your Dick Will Slip Inside Me. My Private Tutor Has Big Tits And Great Cleavage, And When She Pressed Her Tits Into My Arm While Tutoring Me My Dick Go

  • censoredbig titsSWswitchtotchiswitch switchSW-433SW4331sw00433
    • 2016-09-08
    141 min

    [DVDMS-028]Big Sis Rape Rec-2 An Extreme Posting A Cherry Boy Little Brother Can't Avoid Peeking At his Big Sister's Panty Shot And Titty Action, Until One Day, He Loses All Control We've Captured The Entire Act Of Incest On Video

  • censoredsisterDVDMSdeepshironori miyaseDVDMS-028DVDMS0281dvdms00028
    • 2016-07-08
    240 min

    [VRTM-175]Big Brother Is Into His Little Sister And, Without The Parents Knowing, Grabs A Camera And Asks Her To Fuck Him! While She's Embarrassed About Being Filmed Doing Incest, It Also Feels So Good That She Starts Grinding Hard And Cumming Bu

  • censoredcreampiesisterVRTMv r produceakiraVRTM-175VRTM175h-910vrtm00175
    • 2015-12-24
    484 min

    [DVDES-914]Reunited With His Big Tits Sister For The First Time In 15 Years At The Coed Bath, This Little Brother's Cock Is Ready To Rock!! This Amateur Brother And Sister Agreed To Take On Our Sex Challenge During Their Family Vacation! Their Mo

  • censoredDVDESdeepskappa hunting reardeep sDVDES-914DVDES9141dvdes00914
    • 2015-07-23
    181 min

    [DVDES-868]It's Been 15 Years Since This Busty Big Sister Last Took A Bath With Her Little Brother, But This Time He's Rocking An Erection! We Challenge Brothers And Sisters On Family Vacations To A Hot Mission! Slip Into A Mixed Bath Alone T

  • censoredbig titssisterDVDESdeepsgreen house effectdeep sDVDES-868DVDES8681dvdes00868
    • 2015-06-27
    147 min

    [WANZ-363]Exclusive: WANZ-Style Persistent Creampie SPECIAL, Shelly

  • shelly shelly shelley fujii censoredcreampieWANZones factorywanzWANZ-363WANZ363wanz00363



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online