virgin jav censored cowgirl big tits




FC2MILKCESDEBODLULUATIDAMBIKSBJSHKDAWDVEMAGMEMSTARSNATRWAAANNPJNACRJULHODVSSISKBI

2020-11-01
74 min

[HKHS-005]LUCK YOU This Is Your Fate - A Japanese Tourist Locks A Hollywood Girl Down For Some Confinement Breaking In Training - Kiara

  • censoredamateurHKHShikara delusion groupsamuraiHKHS-005HKHS005hkhs00005
    • 2020-11-06
    120 min

    [JUL-370]Elegant Playtime Of A Rich Lady With Time On Her Hands Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-370JUL370jul00370
    • 2020-11-06
    173 min

    [PRED-262]Even If My Testes Are Empty, My Hottie Older Stepsister With The Big Ass Will Still Wanna Carry On Fucking! In Pursuit! Butt Nympho Full Course With Aika Yamagishi

  • aika yamagishi censoredcreampieslutPREDpremiumcontour styleelegancePRED-262PRED262pred00262
    • 2020-11-18
    64 min

    SIRO-4328 [First shot] [Back bite of G milk model] [Super glamor body] A gravure model that shows outstanding proportions. The swaying huge breasts of a beautiful model that I had no choice but to imagine is the most obscene .. AV application on the

  • amateur censoredbig titsamateursirosiro-4328siro4328siro-4328
    • 2020-11-20
    75 min

    [OTIM-045](Online Exclusive) (Daydream POV) "My Teacher Calls Me After Class Every Day To Do Dirty Things" Rara Momota

  • also brought censoredcreampieuniformOTIMprestigeonetimeOTIM-045OTIM045118otim00045
    • 2020-11-26
    481 min

    [FCDSS-005]Sex Goddesses - Suzume Mino - First Best FALENO Debut 1st Anniversary - 8 Titles, 8-Hour Special

  • suzume mino censoredbig titssingle workFCDSSfalenofaleno starFCDSS-005FCDSS0051fcdss00005
    • 2020-12-04
    149 min

    [HODV-21532]A High-Class Snack Bar Madam How Are You Doing Tonight？ You Like An Adult Relationship, Don't You？ Reika Hashimoto

  • reika hashimoto censoredcreampiesquirtingHODVh m pHODV-21532HODV215325642hodv21532
    • 2020-12-05
    143 min

    [JUL-395]My Naughty Former Teacher Hired Me As A Callgirl And Made Me Into His Obedient Sex Pet... Mahiro Ichiki

  • mahiro ichiki censoredmature womansingle workJULmadonnajotaro tomiJUL-395JUL395jul00395
    • 2020-12-11
    35 min

    FC2PPV 1602955 [Personal shooting] Rural Yan Mama, 21 years old, goes to Tokyo with her children! Pour semen into the back of the vagina by devouring a plump young body

  • amateur uncensoredfc2
    • 2020-12-25
    53 min

    [ETQR-183](Daydream POV) Receptionist Who Wants To Get Ravished AOI Aoi Nakajo

  • nakagusuku censoredcreampieuniformETQRerotic timeETQR-183ETQR183h-1186etqr00183
    • 2021-01-15
    195 min

    [GZAP-040]My Colleague Is An Unattainable Flower, But This Office Lady Is A Perverted And Crazy Exhibitionist She Likes To Film Herself During Masturbation Outdoors, During Work Hours, And When I Saw Her Glistening With Hot, Buttery And Orgasmic Pass

  • censoredGZAPprestigehimurokkuzapGZAP-040GZAP040118gzap00040
    • 2021-01-18
    83 min

    300MIUM-674 [Crazy 10P Gangbang] Active Dirty High School Teacher Wife vs Nine Sexualists! Multicolored Chi ● Ko is a nasty Ma with a happening bar ● Ko is a mess! Inevitable trance state of runaway “Look at the place where everyone is in”

  • amateur censoredcreampiemarried womanmiummium-674mium674300mium-674
    • 2021-01-21

    FC2PPV 1653544 * Until noon on the 24th 4480pt → 3980pt [None] Three past works of tall G-cup busty daughter! * New trailer video + high-quality version of the main story with review benefits

  • amateur uncensoredfc2
    • 2021-01-22
    51 min

    [oretd-835]あおいちゃん

  • amateur censoredcreampieuniformoretdoretd-835oretd835oretd-835
    • 2021-01-23
    52 min

    FC2PPV 1656863 [Personal shooting] First shot & first vaginal cum shot ★ Luna 20-year-old maid cafe clerk! I will do the first vaginal cum shot and Gonzo in my life.

  • amateur uncensoredfc2
    • 2021-02-03
    120 min

    [pow-038]べりか☆逆バニー

  • amateur censoredbig titsamateurpowpow-038pow038pow-038
    • 2021-02-11
    167 min

    [NHDTB-493]Reverse NTR A Slippery And Slimy Threesome Fuck Fest Involving Your Wife When Your Wife Caught Your Married Dick Pumping Away At This Girl And Giving Her Creampie Sex, She Got Dripping Wet With Jealousy And Decided To Join In The Fun.

  • censoredcreampiebig titsNHDTBnatural highbacon tanakaNHDTB-493NHDTB4931nhdtb00493
    • 2021-02-11
    74 min

    [orec-690]ゆきね

  • amateur censoredcreampiebig titsorecorec-690orec690orec-690
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    40 min

    417SRYA-010 I was targeted by a slime milk crocodile! !! There is a woman’s predecessor in the open-air bath … The cock begins to react to the naked woman’s body, straddling the awkward me, and the semen tank is empty due to the angry

  • amateur censoredcreampiebig titssryasrya-010srya010417srya-010
    • 2021-02-19
    12 min

    FC2PPV 1693328 Rio Yukopi Tech I had him pull out with a camera while I was playing

  • amateur uncensoredfc2
    • 2021-02-21
    198 min

    [MISM-195]The Craziest Deep Throating Secretaries: Deep Throat Service Special - Ayaka Mochizuki, Kanade Tsuchiya

  • ayaka mochizuki kana tsuchiya censoreddeepthroatMISMm girls labkokoa kuroMISM-195MISM195mism00195
    • 2021-03-05
    62 min

    374SHOW-046 Mana (22)

  • amateur censoredcreampieamateurshowshow-046show046374show-046
    • 2021-03-09
    49 min

    FC2PPV 1719198 * Limited time 3980⇒2980pt ★ Super rare amateur ☆ Lori girl Mayatan 19 years old re-advents in a nasty maid! ☆ Decaprickets are addictive ♥ Electric Maiki ♥ Rich intense blowjob ♥ Gun thrusting into the finest pussy ♥ [Personal shootin

  • amateur uncensoredfc2
    • 2021-03-13
    119 min

    [IPX-633]"I Told You I've Already Ejaculated!" But My Big Stepsister Slut Still Came At Me With Her Musty, Sweaty Pussy Tsumugi Akari

  • akari tsumugi censoredcreampieslutIPXidea pocketusa pyondishIPX-633IPX633ipx00633
    • 2021-03-18
    56 min

    C0930 ki210318 Mitsuko Hayama 43years old

  • amateur uncensoredc0930
    • 2021-03-25
    40 min

    H4610 ki210325 Sayuri Takagi 20years old

  • amateur uncensoredh4610
    • 2021-04-02
    81 min

    FC2PPV 1752257 New students from April. A developing immature body. The erection of immorality does not stop in a real teenage pussy that is neither an adult nor a child, and two mass ejaculations on a young face.

  • amateur uncensoredfc2
    • 2021-04-08
    56 min

    C0930 ki210408 Kazuyo Inaba 38years old

  • amateur uncensoredc0930
    • 2021-04-08
    146 min

    [HAWA-243]Real-Life Sub Ballet Teacher's Nimble Body Tied Up By A Hung Older Man With A BDSM Fetish - Her Supple Flesh Pumped Full Of Cum And Made To Orgasm Yuki, Age 28

  • censoredmarried womanamateurHAWAcosmos videohide monkcosmospictures soft on demandHAWA-243HAWA2431hawa00243
    • 2021-04-17
    153 min

    [HND-983]It's All In The Eyes Creampie Sex With No Words Necessary, All The Love Is Communicated In The Eyes Rena Aoi

  • blue censoredcreampieslutHNDhon nakanao masakiHND-983HND983hnd00983
    • 2021-04-18
    177 min

    [DGCESD-996]- Streaming Only! With Special Footage - Veteran Actress - We Filmed Only What Yui Hatano Wanted To Do

  • yui hatano censoredbig titsmature womanDGCESDcelebrity friendsDGCESD-996DGCESD996dgcesd00996
    • 2021-04-18
    120 min

    [JSOP-001]New: Alluring Bathhouse Cougar - Passionate Mature Sex At A High Class Soapland Brothel Mio Morishita

  • mio morishita censoredmature womansingle workJSOPglobal media entertainmentyayoi nakanomature japanese soaplandJSOP-001JSOP001jsop00001
    • 2021-04-22
    151 min

    [NHDTB-521]Ekiben Style Creampie J* M****ter 5

  • censoredcreampiesquirtingNHDTBnatural highkansukeNHDTB-521NHDTB5211nhdtb00521
    • 2021-04-24
    51 min

    492JCHA-026 There is no reason why JK taken in erotic videos is naive!

  • amateur censoreduniformschoolgirljchajcha-026jcha026492jcha-026
    • 2021-04-28
    38 min

    FC2PPV 1791544 [Uniform fucking pinching] Gentle no-hand fucking pinching from big breasts rubbing in uniform cosplay !! Amateur individual shooting 072

  • amateur uncensoredfc2
    • 2021-05-01
    240 min

    [HUNTB-007]"I Can See Your Nipples, Though...." "Really...？" Bathing With Your C***dhood Friend! You're Both Shy, So She's Covered Herself With A Towel, But... Her Nipple Shows Through, And Little By Little You Get Closer...

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-007HUNTB007huntb00007
    • 2021-05-14
    224 min

    [HUNTB-011]Extremely And Excessively Erotic! I Had The Great Luck To Be There While She Thrust Her Big Ass Out At Me, But Now I Could No Longer Resist This Temptation! I Lost My Mind And Plunged My Cock Inside And Now This Beautiful Lady Was Excited

  • censoredcreampieHUNTBhunterkiteretsuhhh groupHUNTB-011HUNTB011huntb00011
    • 2021-05-22
    132 min

    [GENM-082]Big Titty Woman Fucked At The Massage Parlor Rika Tsubaki

  • tsubaki rika censoredbig titsblowjobGENMgenekig 3GENM-082GENM082genm00082
    • 2021-05-28
    103 min

    [YSN-549]The Odor Of A Precocious Meaty Wife Nene Tanaka

  • nene tanaka censoredcreampiebig titsYSNnonYSN-549YSN549h-127ysn00549
    • 2021-05-29
    130 min

    [EVIS-356]Beautiful Legs: Handjob And Dirty Talk While Showing You The Back Of Her Feet

  • toua kotone otsu alice censoredsluthandjobEVISebisusan mousouzokucherry tomiyamaEVIS-356EVIS356evis00356
    • 2021-06-11
    140 min

    [JUFE-298]My Mom Got Remarried So Now I Have A New Stepfather, And I Hate His Guts, But He Keeps On Going Behind Her Back And Licking And Fucking Me Over And Over Again Until I Have Lost All Hope ... Mei Satsuki

  • satsuki mei censoredschoolgirldeepthroatJUFEfitchJUFE-298JUFE298jufe00298
    • 2021-06-12
    121 min

    [APKH-176]A Sex Trip Where I Was Invited By Miss Campus, A Girl With Super Hard, Beautiful Nipples. The Sexual Service I Got At This Hot Springs Resort Made My Love Juices Flow Out In Thin Strings Karen Asahina

  • karen asahina censoredcreampiesingle workAPKHaurora project annexhaurora project anexAPKH-176APKH176apkh00176
    • 2021-06-20
    130 min

    [DBER-115]Little Demon Queen Violation Hell Episode 10: Crimson Amazoness Kinky Sex Games With Ryomi Honoka

  • suzumi honoka censoredbdsmsingle workDBERbabyentertainmentkikubonred babeDBER-115DBER115dber00115
    • 2021-06-28
    73 min

    FC2PPV 1893351 [3480 → Limited number of 2480] [Complete appearance, first and last Gonzo] Ma ● Donna ● 18-year-old F cup half daughter who is working part-time ❤️ First time inside Iki ❤️ Raw insertion ❤️ Massive vaginal cum shot ❤️

  • amateur uncensoredfc2
    • 2021-07-09
    49 min

    521MGFX-012 Excavation ☆ Big Breasts Amateur 10

  • amateur censoredbig titsamateurmgfxmgfx-012mgfx012521mgfx-012



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online