walnut sakura




FC2PPPDGMEMLULUAMBINNPJEBODCJODAPODVENXAVSASSNIMILKSQTEDASDNACRCESDWANZSSISMIDEHMN

2020-11-19
168 min

[BLK-477]Convenient Free Pussy! Fucking Raw Till Morning With A Horny Bitch Who Loves Older Men 02

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-477BLK477blk00477
    • 2020-11-22
    79 min

    200GANA-2389 Seriously Nampa, first shot. 1557 Taiyaki caught a squeaky student! ？？ Eros is packed tightly instead of anko squeaky w Mochimochi is a perfect balance to eat with just the right texture!

  • amateur censoredbig titssquirtingganagana-2389gana2389200gana-2389
    • 2020-12-04
    95 min

    FC2PPV 1593899 [Appearance] Prefectural girls’ school ③ Boyish beautiful girl. ~ Graduation ~

  • amateur uncensoredfc2
    • 2020-12-12
    71 min

    476MLA-023 Gangbang with an apparel clerk working in Kitasenju ☆ Blonde gal with super beautiful breasts caught in the pool ☆ Drunk and lascivious nature Awakened sensitive body is pierced with decachin and forgets me and cums! !!

  • amateur censoredamateurmlamla-023mla023476mla-023
    • 2020-12-15
    72 min

    HEYZO 2423 Naughty Prank To The New Employee -Part2- – Hikari Endo

  • hikari endo uncensoredcreampiehandjobheyzo
    • 2020-12-18
    32 min

    [BTH-102]Actual Secretary, Natural Slut. Aki Natsume ra

  • akira natsume censoredblowjobBTHchobitchchovicBTH-102BTH102h-1435bth00102
    • 2020-12-19
    76 min

    483HMHM-003 [Domazo Slender] [The lascivious voice doesn’t stop] [I think I’m too lively] [Race Queen who feels like I’m alive] Raw chin is stuck in the back thrust piston in the beautiful shaved piston and the whole body is cramping s

  • amateur censoredbig titsamateurhmhmhmhm-003hmhm003483hmhm-003
    • 2020-12-20
    135 min

    [JUL-409]Impressive Married Secretary - Her Madonna Exclusive Part 3! After Fucking My Husband To Make Babies I Always Take A Creampie From My Father-In-Law... Honoka Kimura

  • honoka kimura censoredcreampiemature womanJULmadonnajotaro tomiJUL-409JUL409jul00409
    • 2021-01-09
    69 min

    200GANA-2421 In the spear room of the Nampa teacher of 100 battles, brought in SEX hidden shooting 187 A busty married woman who brought in with a half-drunk momentum. In addition to the loneliness that her husband hasn’t dealt with recently, sh

  • amateur censoredbig titsmarried womanganagana-2421gana2421200gana-2421
    • 2021-01-14
    52 min

    230OREC-671 Miu sensei

  • amateur censoredcreampieamateurorecorec-671orec671orec-671
    • 2021-01-15
    50 min

    FC2PPV 1645953 ★ First shot super rare amateur ☆ Lori girl ♥ Whip BODY’s nasty Mayatan 19 years old ☆ Too erotic prequette ♥ Squirting involuntarily with electric massage ♥ Sensitive shaved pussy and Gonzo cum shot [Personal shooting] * With ben

  • amateur uncensoredfc2
    • 2021-01-21
    122 min

    [HBAD-572]The Mother Tolerates Her Stepdaughter Being Sacrificed As A Meat Toy To Men - Sara Kanami

  • kagami sara censoreddeepthroatbdsmHBADhibinonamitaro umababeHBAD-572HBAD5721hbad00572
    • 2021-02-17
    61 min

    [sika-049]ことねちゃん(24)

  • amateur censoredcreampieamateursikasika-049sika049sika-049
    • 2021-02-20
    120 min

    [C-2616]Day Trip Spa Mature Woman Lust Trip #017

  • censoredmarried womanmature womanCgogoskoichi takahashicore gogo sC-2616C2616
    • 2021-02-27
    120 min

    [SNKH-009]わたしツルペタだけど黒人さんとヤリたい！ 華奢ロリ美少女が巨漢黒人にガン突かれる！ 河奈亜依

  • ai kawana censoreduniformbeautiful girlSNKHsharksnarkSNKH-009SNKH009h-687snkh00009
    • 2021-03-20
    32 min

    FC2PPV 1734493 * None * Super luxury review benefits! High image quality ☆ Appearance ☆ Sakura-chan, continuous vaginal cum shot with a pursuit piston that does not stop even with teary eyes

  • amateur uncensoredfc2
    • 2021-03-21
    118 min

    [CAWD-190]Pissing! Wetting Yourself! Splishing, Splashing, Shameful Pissing Yui Amane

  • amane yui censoredsquirtingbeautiful girlCAWDkawaiitake dCAWD-190CAWD190cawd00190
    • 2021-03-25
    120 min

    [IENF-131]My Girlfriend's Little Sister Is A Total Nympho？! She Tries Dirty Talk With Me While Her Sister's Nearby, Trying To Seduce Me With Her Man-Eating Instincts - I Can't Believe She's Still A S********l？! She Let Me Fuck Her Raw

  • riria hido kurumi ito censoredcreampieschoolgirlIENFienergytiger kosakaiienfIENF-131IENF1311ienf00131
    • 2021-03-28
    69 min

    SIRO-4471 [First shot] [I can’t tell my boyfriend ..] [Beauty that collapses in pleasure] A high-class beautician with beautiful looks has appeared. If you continue to give pleasure to the beautiful naked body of contact NG normally .. AV applic

  • amateur censoredamateursirosiro-4471siro4471siro-4471
    • 2021-03-28
    49 min

    491TKWA-067 Shake The Big Areola Exposed From The Swimsuit Of A Fair-Skinned Muchimuchi Big Tits Girl And Cum Inside A Thick Pussy

  • amateur censoredcreampiebig titstkwatkwa-067tkwa067491tkwa-067
    • 2021-04-08
    74 min

    [230OREC-736]ひな

  • amateur censoredcreampieuniformorecorec-736orec736230orec-736
    • 2021-04-09
    119 min

    [IPX-642]Sharing A Room With The Boss I Hate On A Business Trip To A Hotel Hot Spring... Ugly, Hung Old Man Makes Me Cum Over And Over Again. Momo Sakura

  • sakura sky momo censoredbig titssingle workIPXidea pocketdishIPX-642IPX642ipx00642
    • 2021-04-10
    151 min

    [CHRV-130]I Bumped Into My Stepsister For The First Time In Ages And Her Big Boobs Had Grown Into Colossal Tits! Shuri, She Went From A 40" H-Cup To A 43" J-Cup!

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-130CHRV130chrv00130
    • 2021-04-10
    106 min

    [NSPS-983]Home For Three Days. Bride Turned Into Her Father-In-Law's Sex Pet. Kanon Nakajo

  • nakajo canon censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-983NSPS983nsps00983
    • 2021-04-17
    117 min

    [CAWD-201]"I Won't Give You To Anybody Else" Stepdad Obsessed With His Stepdaughter Ravishes Her Body And Soul On The Night Before Her Wedding Mayuki Ito

  • maiyuki ito censoredcreampiesingle workCAWDkawaiidragon nishikawaCAWD-201CAWD201cawd00201
    • 2021-04-28
    42 min

    FC2PPV 1790443 "Wait for me to pick you up …" A mother of 35 years old and 2 children with fresh office clothes … After leaving work at 15:00, she was agitated by a cock and freaked out … A neat mom’s bitch fell! [* Bonus

  • amateur uncensoredfc2
    • 2021-05-01
    190 min

    [HUNTA-998]I'm The Only Boy At This School, And When It's Time To Do The Massive School Cleanup, I'm In Panty Shot Heaven! Everywhere I Look, All I See Are Endless Panty Shot Opportunities And That's Got Me Super Excited! Up Until Las

  • censoredcreampieblowjobHUNTAhunterkonjac kanohhh groupHUNTA-998HUNTA998hunta00998
    • 2021-05-07
    119 min

    [MIAA-437]My C***dhood Friend Is A Bad Girl Who Came To Visit Me In The Hospital And Since I Couldn't Move, She Tweaked And Teased My Sensual Nipples And Then She Quietly Started Playing With My Sex-Deprived Cock And Began Firing Off Cum Shots Wi

  • ichika nagano censoredcreampieschoolgirlMIAAmoodyzeveryone s porn starMIAA-437MIAA437miaa00437
    • 2021-07-09
    124 min

    [IPX-685]Smiling Older Sister Forcibly Extracts Semen with a Kind Tone of Voice Erotic Gap Slut Massage Parlor Rio Kuriyama

  • rio kuriyama censoredslutlingerieIPXidea pocketdishIPX-685IPX685ipx00685
    • 2021-08-05
    243 min

    [CVDX-458]She Twisted Her Fingers Into Her Lingerie, Until She Had Stripped To Fully Naked Glory ... A Horny Housewife Undresses - A Deep And Rich Love Affair, While Secretly Peeping At Her Alluring Body - 30 Ladies 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-458CVDX458h-086cvdx00458
    • 2021-08-11
    88 min

    474MUSUME-008 Phosphorus 2

  • amateur censoredcreampieuniformmusumemusume-008musume008474musume-008
    • 2021-08-21
    159 min

    [GNAX-058]VIP - 1BOX - CAR Harem Fucking Reverse Pick Up Tour

  • miki maejima shiori tsukada censoredsluthandjobGNAXnagiranagira kenzonagira nagiraGNAX-058GNAX058gnax00058
    • 2021-08-27
    80 min

    529STCV-007 Mizuki (Minami Mizuki)

  • amateur censoredcreampieschoolgirlstcvstcv-007stcv007529stcv-007
    • 2021-08-31
    75 min

    326KNTR-005 [NTR] Masochist Desire I’M Crazy With Distorted Love … ~ The Neat And Clean Girlfriend I Met At The University Fell Into A Female At The End Of Jealousy And Wanted A Vaginal Cum Shot Sexual Intercourse ~

  • amateur censoredcreampieamateurkntrkntr-005kntr005326kntr-005
    • 2021-09-04
    121 min

    [BADA-021]Female C***dhood Friend With A Super Masochist Wish, Maina Yuri

  • yuuri censoredsingle workBADAbarutanusubashi suidiamondBADA-021BADA021bada00021
    • 2021-09-10
    121 min

    [NGOD-153]Convenience Store HQ Woman 7. Smart, Gorgeous Woman From The Tokyo Office HQ And A Boring Middle Aged Part-Timer From The Country. Mio Kimijima

  • kimishima mio censoredbig titssingle workNGODjet eizomanji groupNGOD-153NGOD153ngod00153
    • 2021-10-23
    130 min

    [AGMX-096]Naked Massage Parlor for Men, The Kagurazaka Parlor

  • scooping miko shion censoredbig titsAGMXsex agentusubashi suiAGMX-096AGMX096agmx00096
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-01
    83 min

    259LUXU-1487 Luxury TV 1477 "I Can’t Forget My Last Sex …" And A Beautiful Business Owner Who Decided To Appear For The Second Time! The Slender Body Covered With Oil Shakes And Is Disturbed By A Big Cock And Goes Crazy In Agony! Ri

  • amateur censoredamateurluxuluxu-1487luxu1487259luxu-1487
    • 2021-11-05
    122 min

    [UMD-801]Pervert At Gyno Clinic! 14 Unknowing Young Wife Is Creampied During Treatment!!

  • himari kinoshita himari hanazawa hikari sena censoredbig titsUMDleodoragon nishikawaUMD-801UMD801125umd00801
    • 2021-11-06
    162 min

    [DNJR-062]Rika Tsubaki"s Dirty Talk, Teasing a Masochistic Male

  • tsubaki rika censoredbig titsslutDNJRinu mousozokumaboroshi koDNJR-062DNJR062dnjr00062
    • 2021-11-11
    116 min

    [AARM-035]Straddles Your Face With Panties That Are See-Through From Below Provoking You to Jerk Off.

  • blue hamazaki mao censoredsquirtingAARMaroma kikakukasai kijinaromaAARM-035AARM035aarm00035
    • 2021-11-25
    240 min

    [SW-812]Step-daughter Gives A Panty Shot With Her Curvy Ass That"s Just Too Much Temptation! "Tell Me More About The Naughty Things Step-mom Can"t Know About" Fakecest Dream Special - Step-daughter And Step-dad Compilation. That Body

  • censoredSWswitchyocchanswitch switchSW-812SW8121sw00812
    • 2021-12-08
    48 min

    229SCUTE-1141 Sena (23) S-Cute Sex (Sena Kasumi) Who Devours The Naked Body Of A Busty Beauty

  • amateur censoredbig titsamateurscutescute-1141scute1141229scute-1141
    • 2021-12-16
    82 min

    200GANA-2605 Seriously Nampa, First Shot. 1729 The ・ Azato Is Cute! Picking Up Jd With Big Boobs And Plump Thighs! Forgive My Body While Being Shy When I Argue … Pant Voice Is Cute And Thorough! Shaking Milk And Hips, Kyun To The Reaction That T

  • amateur censoredbig titsamateurganagana-2605gana2605200gana-2605
    • 2022-01-03
    52 min

    [SHH-034]Nozomi Haneda AV Retirement. A Slut"s Last Arousal. Teasing Dirty Talk, Nipple Fondling, Pull Out Cowgirl Fucking, Swallowing.

  • nozomi haneda censoredslutSHHnatural highraftin maeshiroSHH-034SHH0341shh00034



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online