ex girlfriend




FC2NNPJBLKVEMAONEZHODVCHRVMIDEMEYDDTTGVHWAAACAWDSSISKSBJAMBIHMNDASDVENXAWDDASD

2020-09-17
83 min

435MFC-040 Ema

  • amateur censoredcreampiesquirtingmfcmfc-040mfc040435mfc-040
    • 2020-09-17
    154 min

    [SSNI-858][Mockery] I thought it would be impossible for me to feel like this from fucking

  • see the slope censoredbeautiful girldeepthroatSSNIs1 no 1 stylejo styleSSNI-858SSNI858ssni00858
    • 2020-09-25
    242 min

    [NASH-370]Real Sexy Stories 15

  • natsuko kayama ryoko murakami rikako nakamura naho kuroki censoredbig titsmature womanNASHnadeshikoNASH-370NASH370h-067nash00370
    • 2020-10-10
    428 min

    [KRU-097]Filmed By The Manager Of A Famous Supermarket In The City This Beautiful Married Woman Shoplifter Is Getting Pounded With Creampie Sex With The 20cm Dick Of A Corrupt And Horny Store Manager

  • censoredcreampiebig titsKRUkarmamanji groupKRU-097KRU097kru00097
    • 2020-10-17
    57 min

    C0930 tk0023 Reika Kagawa 28years old

  • amateur uncensoredc0930
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-31
    120 min

    [MIDE-842]My Older Step-Sister Lives With Her Boyfriend, Next To A Thin Wall - We're Whispering Temptations Secretly So He Won't Hear Us! Mizuki Aibu

  • mizuki ai censoredblowjobslutMIDEmoodyzlamb chopmoodyz divaMIDE-842MIDE842mide00842
    • 2020-11-04
    131 min

    [GVH-143]Perverted Medical Records Of Licking An Old Town Doctor's Face And Getting Creampied By Him - Mio Hinata

  • hinata clan censoredcreampiesingle workGVHglory questGVH-143GVH14313gvh00143
    • 2020-11-05
    485 min

    [ABBA-495]Monthly Center Village Survey Bonus Edition 2020's Highest Ranked MILFs - Greatest Hits - 30 Mature Girls, 8 Hours, 2 Discs

  • censoredcreampiemature womanABBAcenter villageABBA-495ABBA495h-086abba00495
    • 2020-11-12
    121 min

    [GUN-689]Today An Older Guy Hired Me... To Crossdress Yu Shiraishi ri

  • yuuri shiraishi censoredcreampiesingle workGUNradixmg yukkybatsugun paradoxGUN-689GUN689433gun00689
    • 2020-11-14
    20 min

    FC2PPV 1569761 First shot 19 years old JD little virgin daughter Haru virgin bitch tension virgin loss

  • amateur uncensoredfc2
    • 2020-11-19
    55 min

    [oretd-804]さやさん

  • amateur censoredcreampieamateuroretdoretd-804oretd804oretd-804
    • 2020-11-22
    172 min

    [AKID-078]College Girls Only! I Took Her Back To My Room After A Party And Shot A Secret Video. I Was Quiet About This And Went To AV no.42: Slutty Huge Breasted Girls, Creampie Edition: Mami/Approximate G-cup, 21 Years Old (She Likes Older Men, So S

  • censoredcreampiebig titsAKIDomochikaeri mousozokumanji groupAKID-078AKID078akid00078
    • 2020-11-28
    53 min

    FC2PPV 1587330 [Personal shooting] Such a 22-year-old is a super beautiful cafe clerk ★ An idol-level beauty shows off to footjob! I was able to take two masterpieces of vaginal cum shot!

  • amateur uncensoredfc2
    • 2020-12-01
    231 min

    [SYK-002](Lust, Gluttony, Sloth) Why Breast Milk？ Naive Real Office Girl, 27 Years Old (Aggressive Girl -> Obedient Sub) Adorable Chinatsu Asamiya, Hometown: Okayama, Hobbies: Movies, Masturbation (14 Times A Week) (Rainy Season)

  • chinatsu asamiya censoredcreampieamateurSYKplumsex food and sleepshirouto only plumSYK-002SYK002h-113syk00002
    • 2020-12-12
    118 min

    [MIAA-361]The Night Of Their Field Trip... Busty Teacher Stripped Down By Her S*****ts During A Game Of Truth Or Dare Gets Fucked Nene Tanaka

  • nene tanaka censoredbig titssingle workMIAAmoodyzhiroaeveryone s porn starMIAA-361MIAA361miaa00361
    • 2020-12-24
    158 min

    [HAWA-233]"I Want Multiple Orgasms" Horny Slut Pounded By A Huge Cock Until She Swoons With Ecstasy! Momoka, Age 23, H-Cup

  • censoredbig titsHAWAcosmos eizohawai nagasecosmospictures soft on demandHAWA-233HAWA2331hawa00233
    • 2020-12-25
    55 min

    FC2PPV 1619604 [Ends as soon as 30 OFF is gone] Two of the strongest beautiful girls in history will double perform as Santa on a holy night! !! As a result, it will be amazing ❤ With sequel benefits

  • amateur uncensoredfc2
    • 2020-12-31
    27 min

    S-Cute 731_kanon_08 Soaked SEX that warms the body wet with rain / Kanon

  • kanon censoredamateurkanonkanon-08kanon08731-kanon-08
    • 2021-01-01
    82 min

    [SS-011]Healing Time Honoka Tsujii

  • censoredcreampieschoolgirlSSglory questSS-011SS011h-113ss00011
    • 2021-01-08
    13 min

    FC2PPV 1637098 [Semi-nothing, stealing 〇] Reverse massage that breaks the rules for men’s estheticians with slender legs

  • amateur uncensoredfc2
    • 2021-01-14
    119 min

    [FGAN-031]Creampie In A Huge Pussy Girl Mai - Mai Yahiro

  • mai yahiro censoredcreampiesingle workFGANfetish eyesFGAN-031FGAN031h-1440fgan00031
    • 2021-01-15
    51 min

    328HMDN-328 [Amateur / Personal shooting] Real cheating video of a 39-year-old wife with a beautiful breasts nice body A big cock is screwed into a tight waist and seeded. Eros is too harsh to go around and die!

  • amateur censoredcreampiebig titshmdnhmdn-328hmdn328328hmdn-328
    • 2021-01-21
    151 min

    Caribbeancom 012121-001 Loli Girl Anthology Mihono, Mao Sena, Wakaba Onoue, Riko Tabe, Nagisa

  • mihono mao uncensoredcreampiehandjobcaribbeancom
    • 2021-02-11
    225 min

    [PIYO-103]This S********l Had Such A Nice Personality And Was So Sensual That We Had Lovey-Dovey, Mind-Blowing Anal Sex!

  • censoredanalschoolgirlPIYOhyokopiero daPIYO-103PIYO1031piyo00103
    • 2021-02-11
    113 min

    [XMOM-028]Enchanting Semen Wife - Continuous Fuck With A Beautiful Wife Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemarried womanXMOMcenter villagesky cloudspink breathXMOM-028XMOM028h-086xmom00028
    • 2021-02-18
    178 min

    [SSNI-995]Hiyori Yoshioka's S1 Graduation - Starting With Her Final Trip To The Hot Springs (Uned! All POV! Plus No Makeup？!) Real Horny Instinctive Naughty SEX! Refreshing, Raw, Graphic, Ultra Rare 200 Erotic Private Fucks Finally Made Public

  • hiyori yoshioka censoredbeautiful girlsingle workSSNIs1 no 1 styleSSNI-995SSNI995ssni00995
    • 2021-02-22
    39 min

    305TRUMG-135 Yuhato Yurie

  • amateur censoredmarried womanamateurtrumgtrumg-135trumg135305trumg-135
    • 2021-03-06
    193 min

    [JUL-486]Yuko Shiraki Commemorating Her 100th Exclusive Madonna Video Special Edition!! She Sucked Out All Of The Semen From Every Single Male Guest At A Hot Spring Resort Inn. (Let's Celebrate) A 100th Anniversary Surprise & 100 Questions Inc

  • shiraki yuko censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-486JUL486jul00486
    • 2021-03-10
    37 min

    [ore-764]モモカ 2

  • amateur censoredcreampieamateuroreore-764ore764ore-764
    • 2021-03-19
    107 min

    [MBDD-2053]Shoko Takahashi / Emerald Seduction

  • shoko takahashi censoredbeautiful girlsingle workMBDDmedia brandMBDD-2053MBDD2053301mbdd02053
    • 2021-03-26
    239 min

    [ASI-032]Married Woman's First Time On Camera 24 I'm Going To Film Myself Fucking This Married Woman

  • censoredcreampiebig titsASIprestigekanbiASI-032ASI032118asi00032
    • 2021-04-23
    161 min

    [MIDE-921]Maybe, Just Maybe ... Tonight (She Whispered Into My Ear), You Just Might Get Your Cherry Boy Graduation My Lady Boss Missed The Last Train Home, So When We Went To Spend The Night Together At A Business Hotel, She Found Out That I Was A Ch

  • mizuki ai censoredcreampieblowjobMIDEmoodyzgoemonmoodyz divaMIDE-921MIDE921mide00921
    • 2021-05-07
    164 min

    [EBOD-821]"I Was Raised By My Father, So I Do Almost All Of The Housework! That's Why I'm Great At Cooking!" She's Super Nice And Super Domestic!! Ichika Seta Is A Super Voluptuous G-Cup Babe Who Is Unable To Control Her Curiosity

  • kazuhana seta censoredbig titssingle workEBODe bodykyoseiEBOD-821EBOD821ebod00821
    • 2021-05-08
    149 min

    [USAG-029]This Plain Jane Big Tits Girl With H-Cup Titties Is Infatuated With Big Dicks, So I'm Going To Make Her Dreams Cum True And Cut Her Down To Orgasmic Size With My Huge Cock! Cosplay/Creampie Sex/A Tall Girl/Otaku/Lives In The Country

  • censoredcreampiebig titsUSAGrabbit daydreamersUSAG-029USAG029usag00029
    • 2021-05-14
    136 min

    [SSIS-064]When The Housewife Next Door Hangs Her Panties Up To Dry On The Balcony During The Day It Means Her Husband's Not Home Aika Yumeno

  • yumeno aika censoredbig titssingle workSSISs1 no 1 stylemametaro mamezawaSSIS-064SSIS064ssis00064
    • 2021-06-04
    122 min

    [UMD-781]A Fresh Face Office Lady Who Was Targeted During The Company Trip 2

  • himari kinoshita himari hanazawa nana maeno censoredUMDleodragon nishikawaUMD-781UMD781125umd00781
    • 2021-06-11
    148 min

    [MEYD-684]Time Stopping - The Pleasure From An Aphrodisiac Explodes In A Twitching Orgasm! Mihina

  • mihina azumihina mihina nagai censoredcreampiesingle workMEYDtameike gorokitorune kawaguchiMEYD-684MEYD684meyd00684
    • 2021-06-16
    161 min

    [MVSD-469]Extreme Nipple Harem - Nipple Squeezing And Sucking! Nipples Teased From Every Direction For The Ultimate Nipple Pleasure! Ichika Matsumoto Aoi Kururugi Rena Aoi

  • ichika matsumoto aoi kururugi censoredcreampiebeautiful girlMVSDm s video groupsamoariMVSD-469MVSD469mvsd00469
    • 2021-06-20
    141 min

    [APKH-178]I Was Invited By A Y********l Who Loves Older Men Using Her Secret Account To Stay At A Hot Spring And Fuck All Day And Night Sex Video Rin Miyazaki

  • miyazaki rin censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-178APKH178apkh00178
    • 2021-06-22
    124 min

    [SDAB-180]Covered in the Juice of a Fresh Body, the Juice, Sweat, Flow and Sperm Bounce Off of a Fresh and Youthful Body! Comes 10 times!! A Barely Legal H Cup Chick with a Smiling Youthful Face. Riho Takashi

  • riho takahashi censoredbig titsschoolgirlSDABsod createbiba gonzoseishun jidaiSDAB-180SDAB1801sdab00180
    • 2021-06-27
    47 min

    FC2PPV 1891491 [Individual shooting 43] Appearance 20 years old Black hair neat and clean streak pie bread Cleaning blowjob from continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-07-06
    85 min

    FC2PPV 1907983 A boxed girl living in Minato Ward. She has a frustrated body that can’t forget sex. The aching pussy can not be suppressed … Libido is released to a dedicated ejaculation toy with an unequaled cock.

  • amateur uncensoredfc2
    • 2021-07-09
    95 min

    300MIUM-722 Active Female College Student With Transcendental Legs! !! !! It doesn’t matter if you have a boyfriend, it’s a playful game that devours Ji ● Ko! !! [Sucking a big cock from your mouth! !! ] × [Drunk Ma ● Ko increases sensitivi

  • amateur censoredamateurmiummium-722mium722300mium-722
    • 2021-07-09
    49 min

    521MGFX-012 Excavation ☆ Big Breasts Amateur 10

  • amateur censoredbig titsamateurmgfxmgfx-012mgfx012521mgfx-012
    • 2021-07-26
    78 min

    FC2PPV 1942105 [9980 → 7/31 2980] [Sss] 2021 Highest Rank Beauty Advent ❤️ Active Ca ❤️ Life’S First Climax Ecstasy ❤️ Beautiful Girl Who Knew The Joy Of Pleasure Miya Aiming For A Large Amount Of Raw Vaginal Cum Shot ❤️

  • amateur uncensoredfc2



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online