voluptuous




FC2KSBJAWDFSDSSMARAVENUPREDPPPDWANZBBANJUFESTARSGMEMSHKDSQTEHMNMIDVSPRDGVHROYDMIDE

2023-10-21
121 min

MKMP-530 Her Best Friend, A Big-breasted Gal, Woos Her With A Voluptuous Tit Fuck And A Lewd Sucking Pacifier.Rika Tsubaki

  • tsubaki rika censoredcreampiesingle workMKMPkm produceichiro kanedamillionMKMP-530MKMP530mkmp00530
    • 2023-10-20
    151 min

    SSIS-926 The Unconscious Temptation That Captivates Men, The Voluptuous Feeling That Cannot Be Hidden, The Selfish Hcup Costume, Konan Koyoi

  • koyoi konan censoredsingle workSSISs one number one stylegoemons1 no 1 styleSSIS-926SSIS926ssis00926
    • 2023-10-17
    84 min

    494SIKA-321 Voluptuous Art College Student Goes Crazy With Hard Play

  • amateur censoredcreampiebig titssikasika-321sika321494sika-321
    • 2023-10-16
    98 min

    SUKE-176 [A Powerful H-cup Charm From A Z-generation Gal] Infiltrating A Personal Photoshoot Of A Gravure Idol Who Is Not Selling Well → "If You Give Me Money, I"m OK With Sex Anytime♪" A Super Slutty Slut Who Makes Full Use Of Her Volupt

  • amateur censoredcreampiebig titssukesuke-176suke176suke-176
    • 2023-10-13
    120 min

    KAM-155 Her Frustration Explodes, And Her Voluptuous Lustful Wife Has An Affair With The Men On Both Sides Of The Apartment. She Shakes Her Big Breasts And Butts And Gets Messy. Hana Haruna

  • haruna hana censoredcreampiesingle workKAMkarmagroupKAM-155KAM155kam00155
    • 2023-10-07
    152 min

    FCDC-156 Bukkake Voluptuous Big Breasts Big Ass Secretary Is A Perverted Lewd Slut Who Seduces Employees With Nipples.

  • censoredslutFCDCweekenderkashimaFCDC-156FCDC156fcdc00156
    • 2023-10-07
    125 min

    AVSA-269 SUPER FISHEYE FETISHISM Powerful Exciting Honey Photography Voluptuous BODY Masochist Wife MASK MASOCHHISM

  • censoredbig titsAVSAavs collector sbuddha davscollector sAVSA-269AVSA269avsa00269
    • 2023-10-07
    124 min

    NITR-540 [4K] Dick-crazy Wife With A Lewd Voluptuous Body X Mary Tachibana

  • tachibana mary censoredcreampiecosplayNITRcrystal picturenitroNITR-540NITR540nitr00540
    • 2023-10-07
    119 min

    NASH-962 The Precum Is Amazing... A Voluptuous Mother-in-law Seduces Her Son And Has Sex

  • censoredmilfmature womanNASHpinknadeshikoNASH-962NASH962nash00962
    • 2023-10-06
    120 min

    DASS-235 Hana Himesaki, A Girl Whose Breasts Are So Voluptuous That They Fall Out Of The Rope

  • himesaki hana censoredbig titsschoolgirlDASSdassrokusaburo mishimaDASS-235DASS235dass00235
    • 2023-09-30
    148 min

    FLAV-335 The Rumored Idol Schoolgirl Is A Devilish Slut Who Seduces The Old Man With Her Plump And Voluptuous Breasts, Misono Mizuhara

  • suwon miso censoredschoolgirlslutFLAVdigital arckashimadigital arkFLAV-335FLAV335flav00335
    • 2023-09-29
    154 min

    DVEH-015 Yuina Taki, A Tall And Beautiful Personal Trainer With A Voluptuous Big Butt Who Repeats The Temptation To Collapse Her Rationality In Search Of The Best Protein (sperm)

  • taki yuina censoredcreampiesingle workDVEHdeepspearl father jrdeep s 3rd storeDVEH-015DVEH015dveh00015
    • 2023-09-29
    170 min

    MIAA-982 A Convenient, Plain Glasses Big Breasts, Nipples That Are Compliant, And A Junior Office Lady"s Voluptuous Body Is Rubbed And Creampied Over And Over Again Until The Morning. Miu Arioka Yuri Oshikawa

  • arioka miu yuri sugawa censoredcreampieslutMIAAmoody sfameveryone s kikatanMIAA-982MIAA982miaa00982
    • 2023-09-27
    120 min

    NINE-078 [Super A5 Rank Aged Meat] A Herbivorous Boy Is Raped By His Voluptuous Landlord, Who Is Older Than His Mother, For Rent Arrears And 12 Shots. Mineko (45 Years Old)

  • censoredNINEmercurychateaubriNINE-078NINE078h-1133nine00078
    • 2023-09-23
    119 min

    DOA-049 A Wheat-colored Healthy Plump Body With Voluptuous Big Breasts And Erotic Areolas! ! Sensitive Bitch With Natural I Cup

  • censoredcreampieDOAblack dog delusionDOA-049DOA049doa00049
    • 2023-09-22
    140 min

    JUQ-391 I Used To Be Slender And Plain, But When I Met Him Again, My Plump And Sexually Active Childhood Friend"s Voluptuous Body Squeezed My Sperm To The Limit. Yumi On

  • evening beauty censoredslutsingle workJUQmadonnaichiro kanedaJUQ-391JUQ391juq00391
    • 2023-09-22
    142 min

    SSIS-871 The Secret Technique Of A Voluptuous Older Sister Who Makes You Ejaculate Secretly When You Can"t Even Make A Sound Is "breast Close Slow Piston" Aika Yumeno

  • yumeno aika censoredslutsingle workSSISs one number one stylehiroharu osakis1 no 1 styleSSIS-871SSIS871ssis00871
    • 2023-09-22
    120 min

    JYMA-042 A Masochist Wife With A Voluptuous Body And Big Breasts Who Can"t Refuse And Opens Her Crotch When A Man Presses Her. A Masochistic Wife Who Gets Teased With Her Big Breasts And Big Ass And Cums Repeatedly. Monami Onizuka

  • onizuka monami censoredcreampiesingle workJYMAmilf is hard mature womanbuddha dgroupJYMA-042JYMA042jyma00042
    • 2023-09-22
    120 min

    JUQ-383 One Month After Saving Up Money And Sperm To Go To A High-class Soap. I Fucked The Big-breasted, Voluptuous Dorm Mother Raw Until Her Rationality Collapsed And All Her Sperm Dried Up! ! Reo Fujisawa

  • reo fujisawa censoredcreampiesingle workJUQmadonnacalifornia summerJUQ-383JUQ383juq00383
    • 2023-09-20
    64 min

    fc2-ppv 3844367 *Only For One Week* [Nympho Masochist Slut] Immediately Fuck The Plump Slut Who Is Rumored On The Dating Site!! Pressure Play With Her Voluptuous Body & Sweaty And Juicey Flesh Fuckin That Goes Crazy With The Hard Piston!! [Muremure//

  • amateur uncensoredcreampieamateur
    • 2023-09-20
    61 min

    HEYZO-3159 Kazumi Takahashi [Kazumi Takahashi] Look At Yome"s Foolishness! Vol.3

  • amateur uncensoredcreampiemarried woman
    • 2023-09-20
    121 min

    NXG-443 Raw Paco Incest With A Chubby Big Breasted Mother-in-law. The Son Is Lustful For The Voluptuous Big Body!

  • viewing moon bookmark megumi arina censoredcreampieNXGnextnext groupNXG-443NXG443h-1664nxg00443
    • 2023-09-20
    123 min

    NACR-705 Rin Okae, A Voluptuous Mother Who Indulges In Forbidden Sex While Feeling Guilty When Her Son Leaves The Nest

  • rin okae censoredcreampiemomNACRplanet plustoripishichidomeNACR-705NACR705h-237nacr00705
    • 2023-09-16
    146 min

    TIKB-169 [Hamelog] When I Made A Voluptuous Gal Drink Alcohol, Her Slut Aura Was In Full Swing, So I Took A Sex Shot Of Her! TIKB-169

  • censoredTIKBchikikikikama delusion groupTIKB-169TIKB169tikb00169
    • 2023-09-15
    150 min

    MVSD-560 A Sexual Harassment Training Trip Arranged By Scum Bosses... They Were Planning To Get Them Drunk And Have Sex With Them... The Usually Calm And Voluptuous New Employee Megaton Turns Into A Beast With Alcohol And Aphrodisiacs! Sweaty Flesh S

  • nanhata sohana censoredcreampiesingle workMVSDm s video groupMVSD-560MVSD560mvsd00560
    • 2023-09-12
    53 min

    fc2-ppv 3808389 [Uncensored] [Facial Appearance] Natural Hosteltine H Cup! A Plump Body That Loves Sex. Super Sensitive Clitoris That Loves Electric Massagers So Much That It Ascends 10 Times FC2-PPV-3808389

  • amateur uncensoredamateur
    • 2023-09-08
    120 min

    SSIS-860 For 30 Days I Drank Aphrodisiacs Every Day And Endured No Sexual Intercourse... Ka ・ Ra ・"s Harsh Sexual Desire Released! Voluptuous Body Human Bullet Climax Gangi Mari Sex Nitadori Hina

  • nitori hina censoredsingle workSSISs one number one styleinabars1 no 1 styleSSIS-860SSIS860ssis00860
    • 2023-09-08
    150 min

    BANK-142 Creampie Open Air Hot Spring Voluptuous K Cup Nasty Older Sister Hana Haruna

  • haruna hana censoredcreampieuniformBANKmako banktake chanBANK-142BANK142h-1495bank00142
    • 2023-08-29
    90 min

    435MFCS-082 [Big Breasts! × Explosive Butt! × Explosive Tide! Explosive Triple Crown Voluptuous Girls And Off Paco Night ♪] Erotic Selfies On SNS Are Too Strong Sexual Desire Big Boobs & Deca Ass Daughter And SEX ♪ Sensitivity Is Too Harsh And Mass S

  • amateur censoredcreampiebig titsmfcsmfcs-082mfcs082435mfcs-082
    • 2023-08-25
    120 min

    NXG-436 3P In Front Of My Husband... Voluptuous Amateur Wife Edition

  • censoredamateurNXGnextnext groupNXG-436NXG436h-1664nxg00436
    • 2023-08-18
    140 min

    JUQ-359 Super Class Glamorous Hcup Voluptuous Body Madonna Blitz Transfer! ! I Used To Be Slender And Plain ... When I Met Again, My Sperm Was Squeezed To The Limit By The Voluptuous Body Of My Childhood Friend With A Strong Libido. Reo Fujisawa

  • reo fujisawa censoredslutsingle workJUQmadonnaichiro kanedaJUQ-359JUQ359juq00359
    • 2023-08-11
    120 min

    MIMK-135 Brother... Are You Alone？ Live-action Version Reverse Pick-up From A Voluptuous Girl With Big Breasts At The Beach... The Reason Fumika Nakayama Was Able To Cum Directly To A Dangerous Day Raw Fucking Irresponsible

  • nakayama fumika censoredcreampiecosplayMIMKmoody shirose takasemankitsuMIMK-135MIMK135mimk00135
    • 2022-06-28
    12 min

    fc2-ppv 2998677 [Individual Shot] Metropolitan Tennis Club ③ Sensitive, Voluptuous, Black-Haired, Baby-Faced Beautiful Girl She"s Just Curious, But As Soon As I Insert Her, She Cums

  • amateur uncensoreduniformamateur
    • 2023-07-29
    126 min

    EMBZ-279 [Caution For Viewing] Circle Les-pu Video Uncut Unedited Women"s Power Criminal Record Voluptuous Nyotai Explosive Rape! Chloroform And A Stun Gun, Aphrodisiacs Make Her Cum And Squirt. Emi Toyonaga

  • emi toyonaga censoredcreampiesingle workEMBZmature school emanuelmature schoolEMBZ-279EMBZ279embz00279
    • 2023-07-29
    150 min

    LULU-231 A Frustrated Voluptuous Busty Aunt Attacked With A Slut Mask Because I Thought That I Wouldn"t Find Out I Wanted It, So I Made Her Cum Crazy Until She Was Satisfied With The Full Power Of The Youth Piston As You Wanted. Seiri Toa

  • seiri censoredcreampiesingle workLULUlunaticsvragmanLULU-231LULU231lulu00231
    • 2023-07-24
    89 min

    INSTV-466 [Superb Erotic Milk 3P] G-cup Female College Student Chii-chan Is Seeding Her Horny Voluptuous Lewd Body As She Desires♪ Vaginal Ejaculation 2 Consecutive Rich Creampie 3P POV Sex ☆

  • censoredcreampiebig titsINSTVhamedori.network secondeditioninstaINSTV-466INSTV466h-1472instv00466
    • 2023-07-22
    115 min

    BLOR-222 A Busty Nursery Teacher A Solid Teacher At The Kindergarten Was A Dirty Little Girl With A Voluptuous Body Unequaled Ji Po Was Poked And Made To Do M & Iki Rolled Up

  • censoredBLORbroccoli delusion groupbroccolibroccoliBLOR-222BLOR222blor00222
    • 2023-07-22
    116 min

    BLOR-223 A Neat Black Hair Nursery Teacher The Idol Teacher Of The Kindergarten Has A Voluptuous Body And Is Half-crying With A Cock Thrust

  • censoredBLORbroccoli delusion groupbroccolibroccoliBLOR-223BLOR223blor00223
    • 2023-07-21
    55 min

    498DDH-190 [Super Voluptuous Stimulus Strong Play Woman Advent! The Effect Of A Massage That Is Clearly Not For Healing Purposes Is...] Massage With Personal Erotic Desires While Saying That It Is Not That Kind Of Shop! The Customer Who Has Been Made

  • amateur censoredcreampiebig titsddhddh-190ddh190498ddh-190
    • 2023-07-12
    242 min

    PAIS-046 A Record Of 7 Sex Recordings 4 Hours From A Voluptuous Voluptuous Busty Girl Who Was Working At A Seaside House And Became A College Student And Became A Fucking Princess.

  • censoredcreampieamateurPAISmercurypiotsukai day clubPAIS-046PAIS046h-1133pais00046
    • 2023-07-08
    181 min

    MADV-535 [4K] Buttocks Voluptuous BODY Blonde Bitch Slut Gal Has M Temperament Gap Repeatedly Creampies Until Her Physical Strength Continues Limit Explosive Orgasmic FUCK Nissaro Clerk Ranka

  • ranka censoredcreampieblowjobMADVcrystal picturemaniac crystalMADV-535MADV535madv00535
    • 2023-07-08
    128 min

    AVSA-253 SUPER FISHEYE FETISHISM Powerful Excitement Honey Photo Tall Body Voluptuous Sensual Erotic BODY Yuina Taki

  • taki yuina censoredslutAVSAavs collector sbuddha davscollector sAVSA-253AVSA253avsa00253
    • 2023-07-08
    155 min

    MDBK-293 I Reunited With My Childhood Friend"s Voluptuous Body When I Returned Home And Scrambled For Cock Over And Over Again And Again And Again And Again And Again And Again! ! I Was Sweaty And Slutty

  • akari shinmura kurumi momose censoredcreampiebig titsMDBKbazookayosukeMDBK-293MDBK293mdbk00293
    • 2023-07-08
    106 min

    USBA-065 Hime-chan, A Voluptuous Gal Who Can Get Fucked Anytime, Is A Horny Saffle Who Loves Cock! Hime Shirayuki

  • shirayuki hime censoredbig titssquirtingUSBAavs collector sthin blade purpleavscollector sUSBA-065USBA065usba00065
    • 2023-06-30
    170 min

    MIRD-230 When I Preached 3 Sisters With Colossal Breasts Who Walked Around The House Wearing No Bra... 300 Adhesion Degree 300 And I Was Fucked Back In A Voluptuous Siege... A Reversed Position Creampie Harem Hana Himesaki Misono Suwon Maya Kikuchi

  • himesaki hana suwon miso censoredcreampieMIRDmoody strendy yamaguchimoodyz realMIRD-230MIRD230mird00230
    • 2023-06-24
    115 min

    APAK-256 Innocent Fcup Voluptuous Uniform Beautiful Girl Nasty Climax Student Guidance Mito Wakui

  • wakui misato censoredcreampieschoolgirlAPAKaurora project annexrkAPAK-256APAK256apak00256



    • JavBake - Jav uncensored - japanese adult videos - Japan xxx free sex online